Endometriosis Knowledgebase

Search Result

Gene id

973

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CD79A Gene UCSC Ensembl

Aliases

IGA, MB-1

Gene name

CD79a molecule

Alternate names

B-cell antigen receptor complex-associated protein alpha chain, CD79a antigen (immunoglobulin-associated alpha), CD79a molecule, immunoglobulin-associated alpha, MB-1 membrane glycoprotein, ig-alpha, membrane-bound immunoglobulin-associated protein, surface IgM,

Gene location

19q13.2 (41877119: 41881371) Exons: 5 NC_000019.10

Gene summary(Entrez)

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

OMIM

112205

Protein Summary

Protein general information

P11912

Name: B cell antigen receptor complex associated protein alpha chain (Ig alpha) (MB 1 membrane glycoprotein) (Membrane bound immunoglobulin associated protein) (Surface IgM associated protein) (CD antigen CD79a)

Length: 226 Mass: 25,038

Tissue specificity: B-cells.

Sequence

MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYT
WPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGI
ILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
P

Structural information

Protein Domains	Ig-like (33-116) ITAM. (177-205)
Interpro:	IPR007110 IPR013783 IPR003599 IPR003598 IPR013151 IPR003110
Prosite:	PS50835 PS51055
Pfam:	PF00047 PF02189
PDB:	1CV9
PDBsum:	1CV9
MINT:	6491159
STRING:	ENSP00000221972;

Other Databases

GeneCards: CD79A; Malacards: CD79A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002250	adaptive immune response	IEA	biological_process
GO:0004888	transmembrane signaling r eceptor activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005771	multivesicular body	ISS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IBA	cellular_component
GO:0009897	external side of plasma m embrane	ISS	cellular_component
GO:0009897	external side of plasma m embrane	IBA	cellular_component
GO:0019815	B cell receptor complex	ISS	cellular_component
GO:0019815	B cell receptor complex	IBA	cellular_component
GO:0030183	B cell differentiation	ISS	biological_process
GO:0030183	B cell differentiation	IBA	biological_process
GO:0042100	B cell proliferation	ISS	biological_process
GO:0042113	B cell activation	ISS	biological_process
GO:0045121	membrane raft	ISS	cellular_component
GO:0050853	B cell receptor signaling pathway	ISS	biological_process
GO:0050853	B cell receptor signaling pathway	IBA	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0004888	transmembrane signaling r eceptor activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005771	multivesicular body	IEA	cellular_component
GO:0005771	multivesicular body	ISS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IBA	cellular_component
GO:0007166	cell surface receptor sig naling pathway	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009897	external side of plasma m embrane	ISS	cellular_component
GO:0009897	external side of plasma m embrane	IBA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019815	B cell receptor complex	IEA	cellular_component
GO:0019815	B cell receptor complex	ISS	cellular_component
GO:0019815	B cell receptor complex	IBA	cellular_component
GO:0030183	B cell differentiation	IEA	biological_process
GO:0030183	B cell differentiation	ISS	biological_process
GO:0030183	B cell differentiation	IBA	biological_process
GO:0042100	B cell proliferation	IEA	biological_process
GO:0042100	B cell proliferation	ISS	biological_process
GO:0042113	B cell activation	IEA	biological_process
GO:0042113	B cell activation	ISS	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045121	membrane raft	ISS	cellular_component
GO:0050853	B cell receptor signaling pathway	IEA	biological_process
GO:0050853	B cell receptor signaling pathway	ISS	biological_process
GO:0050853	B cell receptor signaling pathway	IBA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005771	multivesicular body	ISS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IBA	cellular_component
GO:0009897	external side of plasma m embrane	ISS	cellular_component
GO:0009897	external side of plasma m embrane	IBA	cellular_component
GO:0019815	B cell receptor complex	ISS	cellular_component
GO:0019815	B cell receptor complex	IBA	cellular_component
GO:0030183	B cell differentiation	ISS	biological_process
GO:0030183	B cell differentiation	IBA	biological_process
GO:0042100	B cell proliferation	ISS	biological_process
GO:0042113	B cell activation	ISS	biological_process
GO:0045121	membrane raft	ISS	cellular_component
GO:0050853	B cell receptor signaling pathway	ISS	biological_process
GO:0050853	B cell receptor signaling pathway	IBA	biological_process

KEGG pathways

hsa04662 B cell receptor signaling pathway
hsa05340 Primary immunodeficiency

Diseases

Associated diseases	References
Agammaglobulinemias	KEGG: H00085
Asthenozoospermia	PMID: 19239426
Cancer	PMID: 19573080
Chronic endometritis	PMID: 24898900
Endometriosis	PMID: 26054109
Endometriosis	INFBASE26054109

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26054109	Endometrio sis			98 (46 with end ometriosis, 52 with benign tum ors)		IL-1 TNF IgG IgA Bcl-6 Blimp-1	Show abstract