Endometriosis Knowledgebase

Search Result

Gene id

90865

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL33 Gene UCSC Ensembl

Aliases

C9orf26, DVS27, IL1F11, NF-HEV, NFEHEV

Gene name

interleukin 33

Alternate names

interleukin-33, DVS27-related protein, interleukin-1 family member 11, nuclear factor for high endothelial venules, nuclear factor from high endothelial venules,

Gene location

9p24.1 (6214590: 6257982) Exons: 11 NC_000009.12

Gene summary(Entrez)

The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

OMIM

608678

Protein Summary

Protein general information

O95760

Name: Interleukin 33 (IL 33) (Interleukin 1 family member 11) (IL 1F11) (Nuclear factor from high endothelial venules) (NF HEV) [Cleaved into: Interleukin 33 (95 270); Interleukin 33 (99 270); Interleukin 33 (109 270)]

Length: 270 Mass: 30,759

Tissue specificity: Expressed at high level in high endothelial venules found in tonsils, Peyer patches and mesenteric lymph nodes. Almost undetectable in placenta. {ECO

Sequence

MKPKMKYSTNKISTAKWKNTASKALCFKLGKSQQKAKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRK
HKRHLVLAACQQQSTVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDL
KKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHS
NCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Structural information

Interpro:	IPR026145
Pfam:	PF15095
PDB:	2KLL 4KC3
PDBsum:	2KLL 4KC3
DIP:	37862
MINT:	1423224
STRING:	ENSP00000370842;

Other Databases

GeneCards: IL33; Malacards: IL33

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002686	negative regulation of le ukocyte migration	IEA	biological_process
GO:0002826	negative regulation of T- helper 1 type immune resp onse	IEA	biological_process
GO:0002830	positive regulation of ty pe 2 immune response	IEA	biological_process
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005694	chromosome	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0030133	transport vesicle	IEA	cellular_component
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IEA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IEA	biological_process
GO:0032736	positive regulation of in terleukin-13 production	IEA	biological_process
GO:0032753	positive regulation of in terleukin-4 production	IEA	biological_process
GO:0032754	positive regulation of in terleukin-5 production	IEA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0042092	type 2 immune response	IBA	biological_process
GO:0043032	positive regulation of ma crophage activation	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0050729	positive regulation of in flammatory response	IBA	biological_process
GO:0050729	positive regulation of in flammatory response	ISS	biological_process
GO:0051024	positive regulation of im munoglobulin secretion	IEA	biological_process
GO:0051025	negative regulation of im munoglobulin secretion	IEA	biological_process
GO:0051607	defense response to virus	IEA	biological_process
GO:0090197	positive regulation of ch emokine secretion	IDA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IEA	biological_process
GO:0002686	negative regulation of le ukocyte migration	IEA	biological_process
GO:0002826	negative regulation of T- helper 1 type immune resp onse	IEA	biological_process
GO:0002830	positive regulation of ty pe 2 immune response	IEA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005694	chromosome	IEA	cellular_component
GO:0005694	chromosome	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0030133	transport vesicle	IEA	cellular_component
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IEA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IEA	biological_process
GO:0032736	positive regulation of in terleukin-13 production	IEA	biological_process
GO:0032753	positive regulation of in terleukin-4 production	IEA	biological_process
GO:0032754	positive regulation of in terleukin-5 production	IEA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0042092	type 2 immune response	IBA	biological_process
GO:0043032	positive regulation of ma crophage activation	IEA	biological_process
GO:0043032	positive regulation of ma crophage activation	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0050729	positive regulation of in flammatory response	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IBA	biological_process
GO:0050729	positive regulation of in flammatory response	ISS	biological_process
GO:0051024	positive regulation of im munoglobulin secretion	IEA	biological_process
GO:0051025	negative regulation of im munoglobulin secretion	IEA	biological_process
GO:0051607	defense response to virus	IEA	biological_process
GO:0090197	positive regulation of ch emokine secretion	IEA	biological_process
GO:0090197	positive regulation of ch emokine secretion	IDA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IEA	biological_process
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0042092	type 2 immune response	IBA	biological_process
GO:0043032	positive regulation of ma crophage activation	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0050729	positive regulation of in flammatory response	IBA	biological_process
GO:0050729	positive regulation of in flammatory response	ISS	biological_process
GO:0090197	positive regulation of ch emokine secretion	IDA	biological_process

KEGG pathways

hsa05164  Influenza A
hsa04217  Necroptosis
hsa04623  Cytosolic DNA-sensing pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19204726
Asthma	PMID: 19198610
Endometriosis	PMID: 22587998
Nasal polyposis	PMID: 19860791
Endometriosis	INFBASE25977120
Polycystic ovary syndrome (PCOS)	PMID: 27146815

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25977120	Endometrio sis		Tunisia n	50 (30 women wi th laparoscopic and histopatho logical confirm ed endometriosi s, 20 control w omen without pe lvic pathology)		ST2 IL-33	Show abstract