Endometriosis Knowledgebase

Search Result

Gene id

8828

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NRP2 Gene UCSC Ensembl

Aliases

NP2, NPN2, PRO2714, VEGF165R2

Gene name

neuropilin 2

Alternate names

neuropilin-2, neuropilin-2a(17), neuropilin-2a(22), neuropilin-2b(0), receptor for VEGF165 and semaphorins class3, vascular endothelial cell growth factor 165 receptor 2,

Gene location

2q33.3 (205682449: 205798132) Exons: 21 NC_000002.12

Gene summary(Entrez)

This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

OMIM

602070

Protein Summary

Protein general information

O60462

Name: Neuropilin 2 (Vascular endothelial cell growth factor 165 receptor 2)

Length: 931 Mass: 104,859

Sequence

MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPH
FEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIRFTSDYARQGAGFSLRYEIFKTGSEDCS
KNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPL
IGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYS
DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVY
RHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQI
SASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFK
VSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPTEEEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSP
NDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQYQATGGRGVALQVVREASQESKLLWVIREDQ
GGEWKHGRIILPSYDMEYQIVFEGVIGKGRSGEIAIDDIRISTDVPLENCMEPISAFAGENFKVDIPEIHEREGY
EDEIDDEYEVDWSNSSSATSGSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSR
SCTTLENYNFELYDGLKHKVKMNHQKCCSEA

Structural information

Protein Domains	CUB (28-142) CUB (149-267) F5/8 (277-427) F5/8 (434-592)
Interpro:	IPR013320 IPR000859 IPR000421 IPR008979 IPR000998 IPR014648 IPR027143 IPR022579
Prosite:	PS01180 PS01285 PS01286 PS50022 PS50060
Pfam:	PF00431 PF11980 PF00754 PF00629
CDD:	cd00041 cd06263
PDB:	2QQJ 2QQK 2QQL 2QQO 4QDQ 4QDR 4QDS 5DN2 5DQ0
PDBsum:	2QQJ 2QQK 2QQL 2QQO 4QDQ 4QDR 4QDS 5DN2 5DQ0
DIP:	5745
STRING:	ENSP00000353582;

Other Databases

GeneCards: NRP2; Malacards: NRP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	NAS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	TAS	biological_process
GO:0002116	semaphorin receptor compl ex	NAS	cellular_component
GO:0004872	receptor activity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	NAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	NAS	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007155	cell adhesion	NAS	biological_process
GO:0007411	axon guidance	NAS	biological_process
GO:0008201	heparin binding	IEA	molecular_function
GO:0010595	positive regulation of en dothelial cell migration	TAS	biological_process
GO:0016020	membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0017154	semaphorin receptor activ ity	NAS	molecular_function
GO:0017154	semaphorin receptor activ ity	NAS	molecular_function
GO:0019838	growth factor binding	TAS	molecular_function
GO:0019955	cytokine binding	NAS	molecular_function
GO:0021675	nerve development	ISS	biological_process
GO:0038084	vascular endothelial grow th factor signaling pathw ay	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048846	axon extension involved i n axon guidance	ISS	biological_process
GO:0061549	sympathetic ganglion deve lopment	ISS	biological_process
GO:0097490	sympathetic neuron projec tion extension	ISS	biological_process
GO:0097491	sympathetic neuron projec tion guidance	ISS	biological_process
GO:1902285	semaphorin-plexin signali ng pathway involved in ne uron projection guidance	ISS	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	NAS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	TAS	biological_process
GO:0002116	semaphorin receptor compl ex	NAS	cellular_component
GO:0004872	receptor activity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IEA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	NAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	NAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	TAS	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007155	cell adhesion	NAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007399	nervous system developmen t	IEA	biological_process
GO:0007411	axon guidance	IEA	biological_process
GO:0007411	axon guidance	NAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0008201	heparin binding	IEA	molecular_function
GO:0010595	positive regulation of en dothelial cell migration	TAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0017154	semaphorin receptor activ ity	IEA	molecular_function
GO:0017154	semaphorin receptor activ ity	NAS	molecular_function
GO:0017154	semaphorin receptor activ ity	NAS	molecular_function
GO:0019838	growth factor binding	TAS	molecular_function
GO:0019955	cytokine binding	NAS	molecular_function
GO:0021675	nerve development	ISS	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0038084	vascular endothelial grow th factor signaling pathw ay	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048846	axon extension involved i n axon guidance	ISS	biological_process
GO:0061549	sympathetic ganglion deve lopment	ISS	biological_process
GO:0097490	sympathetic neuron projec tion extension	ISS	biological_process
GO:0097491	sympathetic neuron projec tion guidance	ISS	biological_process
GO:1902285	semaphorin-plexin signali ng pathway involved in ne uron projection guidance	ISS	biological_process
GO:0001525	angiogenesis	NAS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	TAS	biological_process
GO:0002116	semaphorin receptor compl ex	NAS	cellular_component
GO:0004872	receptor activity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	NAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	NAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	TAS	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007155	cell adhesion	NAS	biological_process
GO:0007411	axon guidance	NAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0010595	positive regulation of en dothelial cell migration	TAS	biological_process
GO:0016020	membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	NAS	cellular_component
GO:0017154	semaphorin receptor activ ity	NAS	molecular_function
GO:0017154	semaphorin receptor activ ity	NAS	molecular_function
GO:0019838	growth factor binding	TAS	molecular_function
GO:0019955	cytokine binding	NAS	molecular_function
GO:0021675	nerve development	ISS	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048846	axon extension involved i n axon guidance	ISS	biological_process
GO:0061549	sympathetic ganglion deve lopment	ISS	biological_process
GO:0097490	sympathetic neuron projec tion extension	ISS	biological_process
GO:0097491	sympathetic neuron projec tion guidance	ISS	biological_process
GO:1902285	semaphorin-plexin signali ng pathway involved in ne uron projection guidance	ISS	biological_process

Diseases

Associated diseases	References
Autism	PMID: 17427189
Endometriosis	PMID: 23585340
Lymphedema	PMID: 18564921
Obesity	PMID: 19553259
Endometriosis	INFBASE23585340

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23585340	Endometrio sis			79 (37 control, 42 endometrios is)		NRP-1 NRP-2 VEGF-D VEGF-C	Show abstract