Endometriosis Knowledgebase

Search Result

Gene id

8644

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

AKR1C3 Gene UCSC Ensembl

Aliases

DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, PGFS, hluPGFS

Gene name

aldo-keto reductase family 1 member C3

Alternate names

aldo-keto reductase family 1 member C3, 3-alpha hydroxysteroid dehydrogenase, type II, 3-alpha-HSD type II, brain, chlordecone reductase homolog HAKRb, dihydrodiol dehydrogenase 3, dihydrodiol dehydrogenase X, indanol dehydrogenase, prostaglandin F synthase, test,

Gene location

10p15.1 (5048765: 5107685) Exons: 10 NC_000010.11

Gene summary(Entrez)

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

OMIM

603966

Protein Summary

Protein general information

P42330

Name: Aldo keto reductase family 1 member C3 (EC 1. . . ) (17 beta hydroxysteroid dehydrogenase type 5) (17 beta HSD 5) (3 alpha HSD type II, brain) (3 alpha hydroxysteroid dehydrogenase type 2) (3 alpha HSD type 2) (EC 1.1.1.357) (Chlordecone reductase homolog

Length: 323 Mass: 36,853

Tissue specificity: Expressed in many tissues including adrenal gland, brain, kidney, liver, lung, mammary gland, placenta, small intestine, colon, spleen, prostate and testis. The dominant HSD in prostate and mammary gland. In the prostate, higher levels

Sequence

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVK
REDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEA
MEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDK
RWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY

Structural information

Interpro:	IPR018170 IPR020471 IPR023210
Prosite:	PS00798 PS00062 PS00063
Pfam:	PF00248
CDD:	cd06660
PDB:	1RY0 1RY8 1S1P 1S1R 1S2A 1S2C 1XF0 1ZQ5 2F38 2FGB 3R43 3R58 3R6I 3R7M 3R8G 3R8H 3R94 3UFY 3UG8 3UGR 3UWE 4DBS 4DBU 4DBW 4DZ5 4FA3 4FAL 4FAM 4H7C 4HMN 4WDT 4WDU 4WDW 4WDX 4WRH 4XVD 4XVE 4YVV 4YVX 4ZFC 5HNT 5HNU
PDBsum:	1RY0 1RY8 1S1P 1S1R 1S2A 1S2C 1XF0 1ZQ5 2F38 2FGB 3R43 3R58 3R6I 3R7M 3R8G 3R8H 3R94 3UFY 3UG8 3UGR 3UWE 4DBS 4DBU 4DBW 4DZ5 4FA3 4FAL 4FAM 4H7C 4HMN 4WDT 4WDU 4WDW 4WDX 4WRH 4XVD 4XVE 4YVV 4YVX 4ZFC 5HNT 5HNU
MINT:	1379107
STRING:	ENSP00000369927;

Other Databases

GeneCards: AKR1C3; Malacards: AKR1C3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000060	protein import into nucle us, translocation	IDA	biological_process
GO:0001523	retinoid metabolic proces s	TAS	biological_process
GO:0001758	retinal dehydrogenase act ivity	IDA	molecular_function
GO:0004032	alditol:NADP+ 1-oxidoredu ctase activity	IDA	molecular_function
GO:0004033	aldo-keto reductase (NADP ) activity	TAS	molecular_function
GO:0004033	aldo-keto reductase (NADP ) activity	TAS	molecular_function
GO:0004745	retinol dehydrogenase act ivity	IDA	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006693	prostaglandin metabolic p rocess	IEP	biological_process
GO:0006693	prostaglandin metabolic p rocess	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007584	response to nutrient	IEP	biological_process
GO:0008202	steroid metabolic process	IEP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008584	male gonad development	IEP	biological_process
GO:0009267	cellular response to star vation	IEP	biological_process
GO:0010942	positive regulation of ce ll death	IDA	biological_process
GO:0016488	farnesol catabolic proces s	IDA	biological_process
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinon e or similar compound as acceptor	IDA	molecular_function
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinon e or similar compound as acceptor	IDA	molecular_function
GO:0018636	phenanthrene 9,10-monooxy genase activity	IDA	molecular_function
GO:0019371	cyclooxygenase pathway	TAS	biological_process
GO:0030216	keratinocyte differentiat ion	IEP	biological_process
GO:0034614	cellular response to reac tive oxygen species	IDA	biological_process
GO:0035410	dihydrotestosterone 17-be ta-dehydrogenase activity	IDA	molecular_function
GO:0036130	prostaglandin H2 endopero xidase reductase activity	TAS	molecular_function
GO:0036131	prostaglandin D2 11-ketor eductase activity	TAS	molecular_function
GO:0042448	progesterone metabolic pr ocess	IDA	biological_process
GO:0042572	retinol metabolic process	IEA	biological_process
GO:0042574	retinal metabolic process	IDA	biological_process
GO:0044259	multicellular organismal macromolecule metabolic p rocess	IEP	biological_process
GO:0044597	daunorubicin metabolic pr ocess	IMP	biological_process
GO:0044598	doxorubicin metabolic pro cess	IMP	biological_process
GO:0045550	geranylgeranyl reductase activity	IDA	molecular_function
GO:0045703	ketoreductase activity	IDA	molecular_function
GO:0047017	prostaglandin-F synthase activity	IEA	molecular_function
GO:0047020	15-hydroxyprostaglandin-D dehydrogenase (NADP+) ac tivity	IDA	molecular_function
GO:0047023	androsterone dehydrogenas e activity	IDA	molecular_function
GO:0047035	testosterone dehydrogenas e (NAD+) activity	IEA	molecular_function
GO:0047045	testosterone 17-beta-dehy drogenase (NADP+) activit y	IEA	molecular_function
GO:0047086	ketosteroid monooxygenase activity	IDA	molecular_function
GO:0047115	trans-1,2-dihydrobenzene- 1,2-diol dehydrogenase ac tivity	IEA	molecular_function
GO:0047718	indanol dehydrogenase act ivity	IEA	molecular_function
GO:0047787	delta4-3-oxosteroid 5beta -reductase activity	IDA	molecular_function
GO:0048385	regulation of retinoic ac id receptor signaling pat hway	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0052650	NADP-retinol dehydrogenas e activity	TAS	molecular_function
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	TAS	biological_process
GO:0061370	testosterone biosynthetic process	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070293	renal absorption	NAS	biological_process
GO:0071276	cellular response to cadm ium ion	IDA	biological_process
GO:0071277	cellular response to calc ium ion	IDA	biological_process
GO:0071379	cellular response to pros taglandin stimulus	IDA	biological_process
GO:0071384	cellular response to cort icosteroid stimulus	IDA	biological_process
GO:0071395	cellular response to jasm onic acid stimulus	IDA	biological_process
GO:0071799	cellular response to pros taglandin D stimulus	IDA	biological_process
GO:1900053	negative regulation of re tinoic acid biosynthetic process	IDA	biological_process
GO:2000224	regulation of testosteron e biosynthetic process	IMP	biological_process
GO:2000353	positive regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IDA	biological_process
GO:0000060	protein import into nucle us, translocation	IDA	biological_process
GO:0001523	retinoid metabolic proces s	TAS	biological_process
GO:0001758	retinal dehydrogenase act ivity	IDA	molecular_function
GO:0004032	alditol:NADP+ 1-oxidoredu ctase activity	IDA	molecular_function
GO:0004033	aldo-keto reductase (NADP ) activity	TAS	molecular_function
GO:0004033	aldo-keto reductase (NADP ) activity	TAS	molecular_function
GO:0004745	retinol dehydrogenase act ivity	IDA	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006693	prostaglandin metabolic p rocess	IEP	biological_process
GO:0006693	prostaglandin metabolic p rocess	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007584	response to nutrient	IEP	biological_process
GO:0008202	steroid metabolic process	IEP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008584	male gonad development	IEP	biological_process
GO:0009267	cellular response to star vation	IEP	biological_process
GO:0010942	positive regulation of ce ll death	IDA	biological_process
GO:0016488	farnesol catabolic proces s	IDA	biological_process
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinon e or similar compound as acceptor	IDA	molecular_function
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinon e or similar compound as acceptor	IDA	molecular_function
GO:0018636	phenanthrene 9,10-monooxy genase activity	IDA	molecular_function
GO:0019371	cyclooxygenase pathway	TAS	biological_process
GO:0030216	keratinocyte differentiat ion	IEP	biological_process
GO:0034614	cellular response to reac tive oxygen species	IDA	biological_process
GO:0035410	dihydrotestosterone 17-be ta-dehydrogenase activity	IDA	molecular_function
GO:0036130	prostaglandin H2 endopero xidase reductase activity	TAS	molecular_function
GO:0036131	prostaglandin D2 11-ketor eductase activity	IEA	molecular_function
GO:0036131	prostaglandin D2 11-ketor eductase activity	TAS	molecular_function
GO:0042448	progesterone metabolic pr ocess	IDA	biological_process
GO:0042572	retinol metabolic process	IEA	biological_process
GO:0042574	retinal metabolic process	IDA	biological_process
GO:0044259	multicellular organismal macromolecule metabolic p rocess	IEP	biological_process
GO:0044597	daunorubicin metabolic pr ocess	IMP	biological_process
GO:0044598	doxorubicin metabolic pro cess	IMP	biological_process
GO:0045550	geranylgeranyl reductase activity	IDA	molecular_function
GO:0045703	ketoreductase activity	IDA	molecular_function
GO:0047017	prostaglandin-F synthase activity	IEA	molecular_function
GO:0047020	15-hydroxyprostaglandin-D dehydrogenase (NADP+) ac tivity	IDA	molecular_function
GO:0047023	androsterone dehydrogenas e activity	IDA	molecular_function
GO:0047035	testosterone dehydrogenas e (NAD+) activity	IEA	molecular_function
GO:0047045	testosterone 17-beta-dehy drogenase (NADP+) activit y	IEA	molecular_function
GO:0047086	ketosteroid monooxygenase activity	IDA	molecular_function
GO:0047115	trans-1,2-dihydrobenzene- 1,2-diol dehydrogenase ac tivity	IEA	molecular_function
GO:0047718	indanol dehydrogenase act ivity	IEA	molecular_function
GO:0047787	delta4-3-oxosteroid 5beta -reductase activity	IDA	molecular_function
GO:0048385	regulation of retinoic ac id receptor signaling pat hway	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0052650	NADP-retinol dehydrogenas e activity	TAS	molecular_function
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	TAS	biological_process
GO:0061370	testosterone biosynthetic process	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070293	renal absorption	NAS	biological_process
GO:0071276	cellular response to cadm ium ion	IDA	biological_process
GO:0071277	cellular response to calc ium ion	IDA	biological_process
GO:0071379	cellular response to pros taglandin stimulus	IDA	biological_process
GO:0071384	cellular response to cort icosteroid stimulus	IDA	biological_process
GO:0071395	cellular response to jasm onic acid stimulus	IDA	biological_process
GO:0071799	cellular response to pros taglandin D stimulus	IDA	biological_process
GO:1900053	negative regulation of re tinoic acid biosynthetic process	IDA	biological_process
GO:2000224	regulation of testosteron e biosynthetic process	IMP	biological_process
GO:2000353	positive regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IDA	biological_process
GO:0000060	protein import into nucle us, translocation	IDA	biological_process
GO:0001523	retinoid metabolic proces s	TAS	biological_process
GO:0001758	retinal dehydrogenase act ivity	IDA	molecular_function
GO:0004032	alditol:NADP+ 1-oxidoredu ctase activity	IDA	molecular_function
GO:0004033	aldo-keto reductase (NADP ) activity	TAS	molecular_function
GO:0004033	aldo-keto reductase (NADP ) activity	TAS	molecular_function
GO:0004745	retinol dehydrogenase act ivity	IDA	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006693	prostaglandin metabolic p rocess	IEP	biological_process
GO:0006693	prostaglandin metabolic p rocess	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007584	response to nutrient	IEP	biological_process
GO:0008202	steroid metabolic process	IEP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008584	male gonad development	IEP	biological_process
GO:0009267	cellular response to star vation	IEP	biological_process
GO:0010942	positive regulation of ce ll death	IDA	biological_process
GO:0016488	farnesol catabolic proces s	IDA	biological_process
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinon e or similar compound as acceptor	IDA	molecular_function
GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinon e or similar compound as acceptor	IDA	molecular_function
GO:0018636	phenanthrene 9,10-monooxy genase activity	IDA	molecular_function
GO:0019371	cyclooxygenase pathway	TAS	biological_process
GO:0030216	keratinocyte differentiat ion	IEP	biological_process
GO:0034614	cellular response to reac tive oxygen species	IDA	biological_process
GO:0035410	dihydrotestosterone 17-be ta-dehydrogenase activity	IDA	molecular_function
GO:0036130	prostaglandin H2 endopero xidase reductase activity	TAS	molecular_function
GO:0036131	prostaglandin D2 11-ketor eductase activity	TAS	molecular_function
GO:0042448	progesterone metabolic pr ocess	IDA	biological_process
GO:0042574	retinal metabolic process	IDA	biological_process
GO:0044259	multicellular organismal macromolecule metabolic p rocess	IEP	biological_process
GO:0044597	daunorubicin metabolic pr ocess	IMP	biological_process
GO:0044598	doxorubicin metabolic pro cess	IMP	biological_process
GO:0045550	geranylgeranyl reductase activity	IDA	molecular_function
GO:0045703	ketoreductase activity	IDA	molecular_function
GO:0047020	15-hydroxyprostaglandin-D dehydrogenase (NADP+) ac tivity	IDA	molecular_function
GO:0047023	androsterone dehydrogenas e activity	IDA	molecular_function
GO:0047086	ketosteroid monooxygenase activity	IDA	molecular_function
GO:0047787	delta4-3-oxosteroid 5beta -reductase activity	IDA	molecular_function
GO:0048385	regulation of retinoic ac id receptor signaling pat hway	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0052650	NADP-retinol dehydrogenas e activity	TAS	molecular_function
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	IDA	biological_process
GO:0055114	oxidation-reduction proce ss	TAS	biological_process
GO:0061370	testosterone biosynthetic process	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070293	renal absorption	NAS	biological_process
GO:0071276	cellular response to cadm ium ion	IDA	biological_process
GO:0071277	cellular response to calc ium ion	IDA	biological_process
GO:0071379	cellular response to pros taglandin stimulus	IDA	biological_process
GO:0071384	cellular response to cort icosteroid stimulus	IDA	biological_process
GO:0071395	cellular response to jasm onic acid stimulus	IDA	biological_process
GO:0071799	cellular response to pros taglandin D stimulus	IDA	biological_process
GO:1900053	negative regulation of re tinoic acid biosynthetic process	IDA	biological_process
GO:2000224	regulation of testosteron e biosynthetic process	IMP	biological_process
GO:2000353	positive regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IDA	biological_process

KEGG pathways

hsa01100  Metabolic pathways
hsa00140  Steroid hormone biosynthesis
hsa04913  Ovarian steroidogenesis
hsa00590  Arachidonic acid metabolism

Diseases

Associated diseases	References
Cancer	PMID: 19574343
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Endometriosis	PMID: 25446850
Hyperandrogenism	PMID: 18692800
Hyperandrogenism	PMID: 18692800
Male infertility	PMID: 9758445
Male pseudohermaphroditism (MPH)	PMID: 9758445
Ovarian endometriosis	PMID: 21232532
Ovarian endometriosis	PMID: 21232532
Polycystic ovary syndrome (PCOS)	PMID: 16263811
Endometriosis	INFBASE24035605
Ovarian endometriosis	INFBASE21232532

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
25446850	Endometrio sis		Female infertility	PGF2A AKR1B1 AKR1C3 PLA2G2A PTGS2/COX-2 ABCC4 and PTGFR PLA2G4A and HPGD	Show abstract
21232532	Endometrio sis (ovari an)			PR-AB HSD17B2 SRD5A2 AKR1C1 AKR1C2 AKR1C3 AKR1D1	Show abstract
24035605	Endometrio sis	74 (45 women wi th endometriosi s, 29 normal co ntrols)	Female infertility	Cox-2 mPGES-1 mPGES-2 cPGES and AKR-1C3	Show abstract