Endometriosis Knowledgebase

Search Result

Gene id

836

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CASP3 Gene UCSC Ensembl

Aliases

CPP32, CPP32B, SCA-1

Gene name

caspase 3

Alternate names

caspase-3, CASP-3, CPP-32, PARP cleavage protease, SREBP cleavage activity 1, apopain, caspase 3, apoptosis-related cysteine peptidase, caspase 3, apoptosis-related cysteine protease, cysteine protease CPP32, procaspase3, protein Yama,

Gene location

4q35.1 (184649474: 184627695) Exons: 8 NC_000004.12

Gene summary(Entrez)

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein. [provided by RefSeq, Jul 2008]

OMIM

600636

Protein Summary

Protein general information

P42574

Name: Caspase 3 (CASP 3) (EC 3.4.22.56) (Apopain) (Cysteine protease CPP32) (CPP 32) (Protein Yama) (SREBP cleavage activity 1) (SCA 1) [Cleaved into: Caspase 3 subunit p17; Caspase 3 subunit p12]

Length: 277 Mass: 31,608

Tissue specificity: Highly expressed in lung, spleen, heart, liver and kidney. Moderate levels in brain and skeletal muscle, and low in testis. Also found in many cell lines, highest expression in cells of the immune system.

Sequence

MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLR
ETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRS
LTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQ
YADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH

Structural information

Interpro:	IPR029030 IPR015470 IPR033139 IPR016129 IPR002138 IPR001309 IPR015917
Prosite:	PS01122 PS01121 PS50207 PS50208
CDD:	cd00032
PDB:	1CP3 1GFW 1I3O 1NME 1NMQ 1NMS 1PAU 1QX3 1RE1 1RHJ 1RHK 1RHM 1RHQ 1RHR 1RHU 2C1E 2C2K 2C2M 2C2O 2CDR 2CJX 2CJY 2CNK 2CNL 2CNN 2CNO 2DKO 2H5I 2H5J 2H65 2J30 2J31 2J32 2J33 2XYG 2XYH 2XYP 2XZD 2XZT 2Y0B 3DEH 3DEI 3DEJ 3DEK 3EDQ 3GJQ 3GJR 3GJS 3GJT 3H0E 3ITN
PDBsum:	1CP3 1GFW 1I3O 1NME 1NMQ 1NMS 1PAU 1QX3 1RE1 1RHJ 1RHK 1RHM 1RHQ 1RHR 1RHU 2C1E 2C2K 2C2M 2C2O 2CDR 2CJX 2CJY 2CNK 2CNL 2CNN 2CNO 2DKO 2H5I 2H5J 2H65 2J30 2J31 2J32 2J33 2XYG 2XYH 2XYP 2XZD 2XZT 2Y0B 3DEH 3DEI 3DEJ 3DEK 3EDQ 3GJQ 3GJR 3GJS 3GJT 3H0E 3ITN
DIP:	268
MINT:	147180
STRING:	ENSP00000311032;

Other Databases

GeneCards: CASP3; Malacards: CASP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001782	B cell homeostasis	IEA	biological_process
GO:0002020	protease binding	IEA	molecular_function
GO:0004190	aspartic-type endopeptida se activity	EXP	molecular_function
GO:0004197	cysteine-type endopeptida se activity	IDA	molecular_function
GO:0004197	cysteine-type endopeptida se activity	IDA	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	IEA	molecular_function
GO:0005123	death receptor binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006309	apoptotic DNA fragmentati on	TAS	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	TAS	biological_process
GO:0006921	cellular component disass embly involved in executi on phase of apoptosis	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007605	sensory perception of sou nd	IEA	biological_process
GO:0007611	learning or memory	IEA	biological_process
GO:0008233	peptidase activity	IDA	molecular_function
GO:0008233	peptidase activity	IDA	molecular_function
GO:0008635	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess by cytochrome c	TAS	biological_process
GO:0008656	cysteine-type endopeptida se activator activity inv olved in apoptotic proces s	TAS	molecular_function
GO:0009411	response to UV	IEA	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0010165	response to X-ray	IEA	biological_process
GO:0016005	phospholipase A2 activato r activity	IEA	molecular_function
GO:0016241	regulation of macroautoph agy	TAS	biological_process
GO:0021766	hippocampus development	IEA	biological_process
GO:0030182	neuron differentiation	IBA	biological_process
GO:0030216	keratinocyte differentiat ion	IBA	biological_process
GO:0030218	erythrocyte differentiati on	IDA	biological_process
GO:0030218	erythrocyte differentiati on	TAS	biological_process
GO:0030220	platelet formation	TAS	biological_process
GO:0030889	negative regulation of B cell proliferation	IEA	biological_process
GO:0031264	death-inducing signaling complex	IEA	cellular_component
GO:0032025	response to cobalt ion	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0034349	glial cell apoptotic proc ess	IEA	biological_process
GO:0034612	response to tumor necrosi s factor	TAS	biological_process
GO:0035094	response to nicotine	IEA	biological_process
GO:0035329	hippo signaling	TAS	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0043029	T cell homeostasis	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IGI	biological_process
GO:0043200	response to amino acid	IEA	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	IEA	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045165	cell fate commitment	IEA	biological_process
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IEA	biological_process
GO:0046007	negative regulation of ac tivated T cell proliferat ion	IEA	biological_process
GO:0046677	response to antibiotic	IEA	biological_process
GO:0048011	neurotrophin TRK receptor signaling pathway	IDA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051402	neuron apoptotic process	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:0097153	cysteine-type endopeptida se activity involved in a poptotic process	IMP	molecular_function
GO:0097153	cysteine-type endopeptida se activity involved in a poptotic process	IDA	molecular_function
GO:0097190	apoptotic signaling pathw ay	TAS	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	TAS	biological_process
GO:0097194	execution phase of apopto sis	IMP	biological_process
GO:0097194	execution phase of apopto sis	IDA	biological_process
GO:0097200	cysteine-type endopeptida se activity involved in e xecution phase of apoptos is	IMP	molecular_function
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001782	B cell homeostasis	IEA	biological_process
GO:0002020	protease binding	IEA	molecular_function
GO:0004190	aspartic-type endopeptida se activity	IEA	molecular_function
GO:0004190	aspartic-type endopeptida se activity	EXP	molecular_function
GO:0004197	cysteine-type endopeptida se activity	IEA	molecular_function
GO:0004197	cysteine-type endopeptida se activity	IEA	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	IDA	molecular_function
GO:0004197	cysteine-type endopeptida se activity	IDA	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	IEA	molecular_function
GO:0005123	death receptor binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006309	apoptotic DNA fragmentati on	TAS	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	TAS	biological_process
GO:0006921	cellular component disass embly involved in executi on phase of apoptosis	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007605	sensory perception of sou nd	IEA	biological_process
GO:0007611	learning or memory	IEA	biological_process
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008233	peptidase activity	IDA	molecular_function
GO:0008233	peptidase activity	IDA	molecular_function
GO:0008234	cysteine-type peptidase a ctivity	IEA	molecular_function
GO:0008234	cysteine-type peptidase a ctivity	IEA	molecular_function
GO:0008234	cysteine-type peptidase a ctivity	IEA	molecular_function
GO:0008635	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess by cytochrome c	TAS	biological_process
GO:0008656	cysteine-type endopeptida se activator activity inv olved in apoptotic proces s	TAS	molecular_function
GO:0009411	response to UV	IEA	biological_process
GO:0009611	response to wounding	IEA	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010038	response to metal ion	IEA	biological_process
GO:0010165	response to X-ray	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016005	phospholipase A2 activato r activity	IEA	molecular_function
GO:0016241	regulation of macroautoph agy	TAS	biological_process
GO:0016485	protein processing	IEA	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0021766	hippocampus development	IEA	biological_process
GO:0030182	neuron differentiation	IEA	biological_process
GO:0030182	neuron differentiation	IBA	biological_process
GO:0030216	keratinocyte differentiat ion	IEA	biological_process
GO:0030216	keratinocyte differentiat ion	IBA	biological_process
GO:0030218	erythrocyte differentiati on	IDA	biological_process
GO:0030218	erythrocyte differentiati on	TAS	biological_process
GO:0030220	platelet formation	TAS	biological_process
GO:0030889	negative regulation of B cell proliferation	IEA	biological_process
GO:0031264	death-inducing signaling complex	IEA	cellular_component
GO:0032025	response to cobalt ion	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0034349	glial cell apoptotic proc ess	IEA	biological_process
GO:0034612	response to tumor necrosi s factor	TAS	biological_process
GO:0035094	response to nicotine	IEA	biological_process
GO:0035329	hippo signaling	TAS	biological_process
GO:0035556	intracellular signal tran sduction	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0043029	T cell homeostasis	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IGI	biological_process
GO:0043085	positive regulation of ca talytic activity	IEA	biological_process
GO:0043200	response to amino acid	IEA	biological_process
GO:0043525	positive regulation of ne uron apoptotic process	IEA	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045165	cell fate commitment	IEA	biological_process
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IEA	biological_process
GO:0045786	negative regulation of ce ll cycle	IEA	biological_process
GO:0046007	negative regulation of ac tivated T cell proliferat ion	IEA	biological_process
GO:0046677	response to antibiotic	IEA	biological_process
GO:0048011	neurotrophin TRK receptor signaling pathway	IDA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051402	neuron apoptotic process	IEA	biological_process
GO:0071310	cellular response to orga nic substance	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:0097153	cysteine-type endopeptida se activity involved in a poptotic process	IEA	molecular_function
GO:0097153	cysteine-type endopeptida se activity involved in a poptotic process	IMP	molecular_function
GO:0097153	cysteine-type endopeptida se activity involved in a poptotic process	IDA	molecular_function
GO:0097190	apoptotic signaling pathw ay	TAS	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	TAS	biological_process
GO:0097194	execution phase of apopto sis	IEA	biological_process
GO:0097194	execution phase of apopto sis	IMP	biological_process
GO:0097194	execution phase of apopto sis	IDA	biological_process
GO:0097200	cysteine-type endopeptida se activity involved in e xecution phase of apoptos is	IEA	molecular_function
GO:0097200	cysteine-type endopeptida se activity involved in e xecution phase of apoptos is	IMP	molecular_function
GO:0004190	aspartic-type endopeptida se activity	EXP	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	IDA	molecular_function
GO:0004197	cysteine-type endopeptida se activity	IDA	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0004197	cysteine-type endopeptida se activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006309	apoptotic DNA fragmentati on	TAS	biological_process
GO:0006508	proteolysis	IDA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	TAS	biological_process
GO:0006921	cellular component disass embly involved in executi on phase of apoptosis	TAS	biological_process
GO:0008233	peptidase activity	IDA	molecular_function
GO:0008233	peptidase activity	IDA	molecular_function
GO:0008635	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess by cytochrome c	TAS	biological_process
GO:0008656	cysteine-type endopeptida se activator activity inv olved in apoptotic proces s	TAS	molecular_function
GO:0016241	regulation of macroautoph agy	TAS	biological_process
GO:0030182	neuron differentiation	IBA	biological_process
GO:0030216	keratinocyte differentiat ion	IBA	biological_process
GO:0030218	erythrocyte differentiati on	IDA	biological_process
GO:0030218	erythrocyte differentiati on	TAS	biological_process
GO:0030220	platelet formation	TAS	biological_process
GO:0034612	response to tumor necrosi s factor	TAS	biological_process
GO:0035329	hippo signaling	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IGI	biological_process
GO:0048011	neurotrophin TRK receptor signaling pathway	IDA	biological_process
GO:0097153	cysteine-type endopeptida se activity involved in a poptotic process	IMP	molecular_function
GO:0097153	cysteine-type endopeptida se activity involved in a poptotic process	IDA	molecular_function
GO:0097190	apoptotic signaling pathw ay	TAS	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	TAS	biological_process
GO:0097194	execution phase of apopto sis	IMP	biological_process
GO:0097194	execution phase of apopto sis	IDA	biological_process
GO:0097200	cysteine-type endopeptida se activity involved in e xecution phase of apoptos is	IMP	molecular_function

KEGG pathways

hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05205  Proteoglycans in cancer
hsa04010  MAPK signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05161  Hepatitis B
hsa05145  Toxoplasmosis
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05203  Viral carcinogenesis
hsa04210  Apoptosis
hsa04668  TNF signaling pathway
hsa04657  IL-17 signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa04650  Natural killer cell mediated cytotoxicity
hsa05016  Huntington's disease
hsa05146  Amoebiasis
hsa01524  Platinum drug resistance
hsa05133  Pertussis
hsa05210  Colorectal cancer
hsa05010  Alzheimer's disease
hsa05134  Legionellosis
hsa04115  p53 signaling pathway
hsa05012  Parkinson's disease
hsa05416  Viral myocarditis
hsa04726  Serotonergic synapse
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa04215  Apoptosis
hsa05014  Amyotrophic lateral sclerosis

Diseases

Associated diseases	References
Asthenozoospermia	PMID: 25792659
Azoospermia	PMID: 23359247
Azoospermia	PMID: 21812785
Cancer	PMID: 17071630
Cryptozoospermia	PMID: 25792659
Diminished ovarian reserve (DOR)	PMID: 16730720
Endometriosis	PMID: 24246915
Hypospermatogenesis	PMID: 12010237
Idiopathic recurrent pregnancy loss	PMID: 23218678
Male infertility	PMID: 23359247
Oligoasthenozoospermia	PMID: 25792659
Oligozoospermia	PMID: 23359247
Oligozoospermia	PMID: 19597981
Recurrent miscarriage	PMID: 23218678
Sertoli cell-only syndrome (SCOS)	PMID: 23359247
Spermatogenetic defects	PMID: 26209830
Endometriosis	INFBASE24246915
Teratozoospermia	PMID: 15760967
Varicocele	PMID: 19062002
Varicocele	PMID: 12010237

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24246915	Endometrio sis			62 (32 patients with endometri osis, 30 women without endomet riosis)			Show abstract