Endometriosis Knowledgebase

Search Result

Gene id

80895

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ILKAP Gene UCSC Ensembl

Aliases

ILKAP2, ILKAP3, PP2C-DELTA, PPM1O

Gene name

ILK associated serine/threonine phosphatase

Alternate names

integrin-linked kinase-associated serine/threonine phosphatase 2C, integrin-linked kinase associated phosphatase, protein phosphatase 2c, delta isozyme, protein phosphatase, Mg2+/Mn2+ dependent 1O,

Gene location

2q37.3 (238203701: 238170400) Exons: 12 NC_000002.12

Gene summary(Entrez)

The protein encoded by this gene is a protein serine/threonine phosphatase of the PP2C family. This protein can interact with integrin-linked kinase (ILK/ILK1), a regulator of integrin mediated signaling, and regulate the kinase activity of ILK. Through the interaction with ILK, this protein may selectively affect the signaling process of ILK-mediated glycogen synthase kinase 3 beta (GSK3beta), and thus participate in Wnt signaling pathway. [provided by RefSeq, Jul 2008]

Protein Summary

Protein general information

Q9H0C8

Name: Integrin linked kinase associated serine/threonine phosphatase 2C (ILKAP) (EC 3.1.3.16)

Length: 392 Mass: 42,907

Tissue specificity: Widely expressed. Highest levels expressed in striated muscle. Much lower levels evident in various smooth muscle tissues. {ECO

Sequence

MDLFGDLPEPERSPRPAAGKEAQKGPLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSGSLATSISQMVKTEGK
GAKRKTSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHVILNDITEECRPPSSLITRVSYFAV
FDGHGGIRASKFAAQNLHQNLIRKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAV
DNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKR
CGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAV
QRGSADNVTVMVVRIGH

Structural information

Protein Domains	PPM-type (108-390)
Interpro:	IPR015655 IPR000222 IPR001932
Prosite:	PS01032 PS51746
Pfam:	PF00481
STRING:	ENSP00000254654;

Other Databases

GeneCards: ILKAP; Malacards: ILKAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006470	protein dephosphorylation	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0003824	catalytic activity	IEA	molecular_function
GO:0004721	phosphoprotein phosphatas e activity	IEA	molecular_function
GO:0004721	phosphoprotein phosphatas e activity	IEA	molecular_function
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006470	protein dephosphorylation	IEA	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0043169	cation binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function

Diseases

Associated diseases	References
Endometriosis	PMID: 25872452
Endometriosis	INFBASE25872452

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25872452	Endometrio sis		Chinese	121 (55 ectopic endometrium, 3 3 eutopic endom etrium, 33 wome n with endometr iosis)			Show abstract