Endometriosis Knowledgebase

Search Result

Gene id

7431

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

VIM Gene UCSC Ensembl

Aliases

CTRCT30, HEL113

Gene name

vimentin

Alternate names

vimentin, epididymis luminal protein 113,

Gene location

10p13 (17227934: 17237592) Exons: 9 NC_000010.11

Gene summary(Entrez)

This gene encodes a member of the intermediate filament family. Intermediate filamentents, along with microtubules and actin microfilaments, make up the cytoskeleton. The protein encoded by this gene is responsible for maintaining cell shape, integrity of the cytoplasm, and stabilizing cytoskeletal interactions. It is also involved in the immune response, and controls the transport of low-density lipoprotein (LDL)-derived cholesterol from a lysosome to the site of esterification. It functions as an organizer of a number of critical proteins involved in attachment, migration, and cell signaling. Mutations in this gene causes a dominant, pulverulent cataract.[provided by RefSeq, Jun 2009]

OMIM

193060

Protein Summary

Protein general information

P08670

Name: Vimentin

Length: 466 Mass: 53,652

Tissue specificity: Highly expressed in fibroblasts, some expression in T- and B-lymphocytes, and little or no expression in Burkitt's lymphoma cell lines. Expressed in many hormone-independent mammary carcinoma cell lines. {ECO

Sequence

MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVP
GVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLY
EEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVE
SLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSE
AANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEE
MARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETR
DGQVINETSQHHDDLE

Structural information

Motifs	[IL]-x-C-x-x-[DE] motif.(326-329)
Interpro:	IPR001664 IPR006821 IPR018039 IPR027699
Prosite:	PS00226
Pfam:	PF00038 PF04732
PDB:	1GK4 1GK6 1GK7 3G1E 3KLT 3S4R 3SSU 3SWK 3TRT 3UF1 4MCY 4MCZ 4MD0 4MD5 4MDI 4MDJ 4YPC 4YV3
PDBsum:	1GK4 1GK6 1GK7 3G1E 3KLT 3S4R 3SSU 3SWK 3TRT 3UF1 4MCY 4MCZ 4MD0 4MD5 4MDI 4MDJ 4YPC 4YV3
DIP:	32507
MINT:	118802
STRING:	ENSP00000224237;

Other Databases

GeneCards: VIM; Malacards: VIM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0003725	double-stranded RNA bindi ng	IDA	molecular_function
GO:0005200	structural constituent of cytoskeleton	IDA	molecular_function
GO:0005212	structural constituent of eye lens	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005856	cytoskeleton	IDA	cellular_component
GO:0005882	intermediate filament	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0008022	protein C-terminus bindin g	IPI	molecular_function
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010977	negative regulation of ne uron projection developme nt	IEA	biological_process
GO:0014002	astrocyte development	IEA	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0030049	muscle filament sliding	TAS	biological_process
GO:0031252	cell leading edge	IEA	cellular_component
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043005	neuron projection	IEA	cellular_component
GO:0045109	intermediate filament org anization	IEA	biological_process
GO:0045111	intermediate filament cyt oskeleton	IDA	cellular_component
GO:0060020	Bergmann glial cell diffe rentiation	IEA	biological_process
GO:0060395	SMAD protein signal trans duction	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070307	lens fiber cell developme nt	IEA	biological_process
GO:0097110	scaffold protein binding	IPI	molecular_function
GO:1990254	keratin filament binding	IPI	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0003725	double-stranded RNA bindi ng	IDA	molecular_function
GO:0005198	structural molecule activ ity	IEA	molecular_function
GO:0005198	structural molecule activ ity	IEA	molecular_function
GO:0005200	structural constituent of cytoskeleton	IDA	molecular_function
GO:0005212	structural constituent of eye lens	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005856	cytoskeleton	IDA	cellular_component
GO:0005882	intermediate filament	IEA	cellular_component
GO:0005882	intermediate filament	IEA	cellular_component
GO:0005882	intermediate filament	IEA	cellular_component
GO:0005882	intermediate filament	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0008022	protein C-terminus bindin g	IPI	molecular_function
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010977	negative regulation of ne uron projection developme nt	IEA	biological_process
GO:0014002	astrocyte development	IEA	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0030049	muscle filament sliding	TAS	biological_process
GO:0031252	cell leading edge	IEA	cellular_component
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042995	cell projection	IEA	cellular_component
GO:0043005	neuron projection	IEA	cellular_component
GO:0045103	intermediate filament-bas ed process	IEA	biological_process
GO:0045109	intermediate filament org anization	IEA	biological_process
GO:0045111	intermediate filament cyt oskeleton	IDA	cellular_component
GO:0060020	Bergmann glial cell diffe rentiation	IEA	biological_process
GO:0060395	SMAD protein signal trans duction	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070307	lens fiber cell developme nt	IEA	biological_process
GO:0097110	scaffold protein binding	IPI	molecular_function
GO:1990254	keratin filament binding	IPI	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0003725	double-stranded RNA bindi ng	IDA	molecular_function
GO:0005200	structural constituent of cytoskeleton	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005777	peroxisome	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005856	cytoskeleton	IDA	cellular_component
GO:0005882	intermediate filament	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0008022	protein C-terminus bindin g	IPI	molecular_function
GO:0030049	muscle filament sliding	TAS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0045111	intermediate filament cyt oskeleton	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0097110	scaffold protein binding	IPI	molecular_function
GO:1990254	keratin filament binding	IPI	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component

KEGG pathways

hsa05206 MicroRNAs in cancer
hsa05169 Epstein-Barr virus infection

Diseases

Associated diseases	References
Cataract	KEGG: H01202
Endometriosis	PMID: 20199104
Endometriosis	INFBASE28438065
Ovarian endometriosis	INFBASE24464013
Male infertility	PMID: 15120973
Ovarian endometrioid cysts	PMID: 24464013
Polycystic ovary syndrome (PCOS)	PMID: 24505633
Sertoli cell-only syndrome (SCOS)	PMID: 3394955
Spermatogenetic defects	PMID: 3394955

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
28438065	Endometrio sis			TGFB1 Snail CDH1 VIM PCNA	Show abstract
20199104	Endometrio sis		Female infertility	PRDX6 CORO1A TAGLN2 VIM CFTR GCR HSF1	Show abstract
16750201	Endometrio sis			Vimentin beta-actin ATP synthase beta	Show abstract
24464013	Endometrio sis	9 (8 women with stage III/IV e ndometriosis, 1 women with no signs of the di sease)		collagen ?1(XIV) calmodulin collagen ?(VI) plexin integrin ?V?3 transgelin desmin vimentin	Show abstract