Endometriosis Knowledgebase

Search Result

Gene id

7412

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

VCAM1 Gene UCSC Ensembl

Aliases

CD106, INCAM-100

Gene name

vascular cell adhesion molecule 1

Alternate names

vascular cell adhesion protein 1, CD106 antigen,

Gene location

1p21.2 (100719639: 100739044) Exons: 9 NC_000001.11

Gene summary(Entrez)

This gene is a member of the Ig superfamily and encodes a cell surface sialoglycoprotein expressed by cytokine-activated endothelium. This type I membrane protein mediates leukocyte-endothelial cell adhesion and signal transduction, and may play a role in the development of artherosclerosis and rheumatoid arthritis. Three alternatively spliced transcripts encoding different isoforms have been described for this gene. [provided by RefSeq, Dec 2010]

OMIM

192225

Protein Summary

Protein general information

P19320

Name: Vascular cell adhesion protein 1 (V CAM 1) (VCAM 1) (INCAM 100) (CD antigen CD106)

Length: 739 Mass: 81,276

Tissue specificity: Expressed on inflammed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflammed tissue.

Sequence

MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEG
TTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEI
DLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKN
TVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSF
ENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSSVTVSCKVPSVYPLDRLEIELLKGETILENI
EFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILE
EGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVG
SQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQKSKV

Structural information

Protein Domains	Ig-like (25-105) Ig-like (109-212) Ig-like (223-309) Ig-like (312-399) Ig-like (408-506) Ig-like (511-595) Ig-like (600-684)
Interpro:	IPR003987 IPR007110 IPR013783 IPR008424 IPR013098 IPR003599 IPR003598 IPR013106 IPR013151 IPR003989
Prosite:	PS50835
Pfam:	PF05790 PF07679 PF00047
PDB:	1IJ9 1VCA 1VSC
PDBsum:	1IJ9 1VCA 1VSC
STRING:	ENSP00000294728;

Other Databases

GeneCards: VCAM1; Malacards: VCAM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IEA	biological_process
GO:0002102	podosome	IDA	cellular_component
GO:0002526	acute inflammatory respon se	IEA	biological_process
GO:0002544	chronic inflammatory resp onse	IEA	biological_process
GO:0005178	integrin binding	IDA	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005178	integrin binding	IMP	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005902	microvillus	IDA	cellular_component
GO:0007155	cell adhesion	IDA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IDA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0008131	primary amine oxidase act ivity	IDA	molecular_function
GO:0009308	amine metabolic process	IDA	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010043	response to zinc ion	IEA	biological_process
GO:0010212	response to ionizing radi ation	IEA	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0022614	membrane to membrane dock ing	IEP	biological_process
GO:0030175	filopodium	IDA	cellular_component
GO:0030183	B cell differentiation	IC	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0035094	response to nicotine	IEA	biological_process
GO:0035584	calcium-mediated signalin g using intracellular cal cium source	IGI	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IEA	biological_process
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042383	sarcolemma	IEA	cellular_component
GO:0045177	apical part of cell	IDA	cellular_component
GO:0045471	response to ethanol	IEA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0050839	cell adhesion molecule bi nding	IDA	molecular_function
GO:0050901	leukocyte tethering or ro lling	IDA	biological_process
GO:0050901	leukocyte tethering or ro lling	IEP	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0060326	cell chemotaxis	IEA	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071065	alpha9-beta1 integrin-vas cular cell adhesion molec ule-1 complex	IDA	cellular_component
GO:0071356	cellular response to tumo r necrosis factor	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0002102	podosome	IDA	cellular_component
GO:0002526	acute inflammatory respon se	IEA	biological_process
GO:0002544	chronic inflammatory resp onse	IEA	biological_process
GO:0005178	integrin binding	IEA	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005178	integrin binding	IMP	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005902	microvillus	IDA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IDA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IDA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0008131	primary amine oxidase act ivity	IDA	molecular_function
GO:0009308	amine metabolic process	IDA	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009986	cell surface	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010043	response to zinc ion	IEA	biological_process
GO:0010212	response to ionizing radi ation	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016337	single organismal cell-ce ll adhesion	IEA	biological_process
GO:0022614	membrane to membrane dock ing	IEP	biological_process
GO:0030175	filopodium	IDA	cellular_component
GO:0030183	B cell differentiation	IC	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0035094	response to nicotine	IEA	biological_process
GO:0035584	calcium-mediated signalin g using intracellular cal cium source	IGI	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IEA	biological_process
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042383	sarcolemma	IEA	cellular_component
GO:0045177	apical part of cell	IDA	cellular_component
GO:0045471	response to ethanol	IEA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0050839	cell adhesion molecule bi nding	IDA	molecular_function
GO:0050901	leukocyte tethering or ro lling	IDA	biological_process
GO:0050901	leukocyte tethering or ro lling	IEP	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0060326	cell chemotaxis	IEA	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071065	alpha9-beta1 integrin-vas cular cell adhesion molec ule-1 complex	IDA	cellular_component
GO:0071356	cellular response to tumo r necrosis factor	IEA	biological_process
GO:0002102	podosome	IDA	cellular_component
GO:0005178	integrin binding	IDA	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005178	integrin binding	IMP	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005769	early endosome	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005902	microvillus	IDA	cellular_component
GO:0007155	cell adhesion	IDA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IDA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0008131	primary amine oxidase act ivity	IDA	molecular_function
GO:0009308	amine metabolic process	IDA	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0022614	membrane to membrane dock ing	IEP	biological_process
GO:0030175	filopodium	IDA	cellular_component
GO:0030183	B cell differentiation	IC	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0035584	calcium-mediated signalin g using intracellular cal cium source	IGI	biological_process
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0045177	apical part of cell	IDA	cellular_component
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0050839	cell adhesion molecule bi nding	IDA	molecular_function
GO:0050901	leukocyte tethering or ro lling	IDA	biological_process
GO:0050901	leukocyte tethering or ro lling	IEP	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071065	alpha9-beta1 integrin-vas cular cell adhesion molec ule-1 complex	IDA	cellular_component

KEGG pathways

hsa05166  HTLV-I infection
hsa05418  Fluid shear stress and atherosclerosis
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04668  TNF signaling pathway
hsa04514  Cell adhesion molecules
hsa04064  NF-kappa B signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa05144  Malaria
hsa05143  African trypanosomiasis

Diseases

Associated diseases	References
Endometriosis	PMID: 25473757
Implantation failure	PMID: 19778485
Endometriosis	INFBASE11963839
Multiple sclerosis	PMID: 21833088
Myocardial infarction	PMID: 14615367
Ovarian hyperstimulation syndrome (OHSS)	PMID: 10231053
Polycystic ovary syndrome (PCOS)	PMID: 16968464
Polycystic ovary syndrome (PCOS)	PMID: 22137570
Repeated implantation failure (RIF)	PMID: 18778820
Unexplained infertility	PMID: 19778485

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17678915	Endometrio sis	35 (20 during l uteal phase, 15 during menustr ual phase were selected for th is study based on cycle phase and presence/ab sence of endome triosis )		alpha(V) integrin IL-1 beta MCP-1 RANTES VCAM-1	Show abstract
11963839	Endometrio sis			VCAM-1 ICAM-1	Show abstract
25473757	Endometrio sis	24 (9 patients with endometrio sis, 15 patient s without endom etriosis)	Female infertility	?4?1 VCAM-1	Show abstract