Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 718
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol C3   Gene   UCSC   Ensembl
Aliases AHUS5, ARMD9, ASP, C3a, C3b, CPAMD1, HEL-S-62p
Gene name complement C3
Alternate names complement C3, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1, C3a anaphylatoxin, acylation-stimulating protein cleavage product, complement component 3, complement component C3a, complement component C3b, epididymis secretory sperm binding pr,
Gene location 19p13.3 (6720681: 6677834)     Exons: 41     NC_000019.10
Gene summary(Entrez) Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form the mature protein, which is then further processed to generate numerous peptide products. The C3a peptide, also known as the C3a anaphylatoxin, modulates inflammation and possesses antimicrobial activity. Mutations in this gene are associated with atypical hemolytic uremic syndrome and age-related macular degeneration in human patients. [provided by RefSeq, Nov 2015]
OMIM 120700

Protein Summary

Protein general information P01024  

Name: Complement C3 (C3 and PZP like alpha 2 macroglobulin domain containing protein 1) [Cleaved into: Complement C3 beta chain; C3 beta c (C3bc); Complement C3 alpha chain; C3a anaphylatoxin; Acylation stimulating protein (ASP) (C3adesArg); Complement C3b alph

Length: 1663  Mass: 187,148

Tissue specificity: Plasma. The acylation stimulating protein (ASP) is expressed in adipocytes and released into the plasma during both the fasting and postprandial periods. {ECO

Sequence MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTV
LTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIF
TVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK
EYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEV
VLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVF
VTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQALPYSTVG
NSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDF
IPSFRLVAYYTLIGASGQREVVADSVWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDK
GVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAELQCPQPAARRRRSVQL
TEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLARSN
LDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTV
MQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVI
VPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKEDIPPADLSDQVPDTE
SETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIK
KGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVI
HQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMG
RLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMV
FQALAQYQKDAPDHQELNLDVSLQLPSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHA
KAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGV
DRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDG
KLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDE
VQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLG
AFTESMVVFGCPN
Structural information
Protein Domains
Anaphylatoxin-like. (693-728)
NTR. (1518-1661)
Interpro:  IPR009048 IPR011626 IPR002890 IPR011625 IPR000020 IPR018081 IPR001840 IPR013783 IPR001599 IPR019742 IPR019565 IPR001134 IPR018933 IPR008930 IPR008993
Prosite:   PS00477 PS01177 PS01178 PS50189

Pfam:  
PF00207 PF07678 PF01835 PF07703 PF07677 PF01821 PF01759 PF10569

PDB:  
1C3D 1GHQ 1W2S 2A73 2A74 2GOX 2I07 2ICE 2ICF 2NOJ 2QKI 2WII 2WIN 2WY7 2WY8 2XQW 2XWB 2XWJ 3D5R 3D5S 3G6J 3L3O 3L5N 3NMS 3OED 3OHX 3OXU 3RJ3 3T4A 4HW5 4HWJ 4I6O 4M76 4ONT 4ZH1 5FO7 5FO8 5FO9 5FOA 5FOB 5M6W
PDBsum:   1C3D 1GHQ 1W2S 2A73 2A74 2GOX 2I07 2ICE 2ICF 2NOJ 2QKI 2WII 2WIN 2WY7 2WY8 2XQW 2XWB 2XWJ 3D5R 3D5S 3G6J 3L3O 3L5N 3NMS 3OED 3OHX 3OXU 3RJ3 3T4A 4HW5 4HWJ 4I6O 4M76 4ONT 4ZH1 5FO7 5FO8 5FO9 5FOA 5FOB 5M6W

DIP:  
35180
MINT:   5003988
STRING:   ENSP00000245907;
Other Databases GeneCards:  C3;  Malacards:  C3

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001798 positive regulation of ty
pe IIa hypersensitivity
IEA biological_process
GO:0001934 positive regulation of pr
otein phosphorylation
IDA biological_process
GO:0001970 positive regulation of ac
tivation of membrane atta
ck complex
IEA biological_process
GO:0002507 tolerance induction
IEA biological_process
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0004866 endopeptidase inhibitor a
ctivity
IEA molecular_function
GO:0005102 receptor binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0006508 proteolysis
IEA biological_process
GO:0006631 fatty acid metabolic proc
ess
IEA biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0006955 immune response
TAS biological_process
GO:0006956 complement activation
IMP biological_process
GO:0006956 complement activation
TAS biological_process
GO:0006957 complement activation, al
ternative pathway
TAS biological_process
GO:0006958 complement activation, cl
assical pathway
IEA biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological_process
GO:0007596 blood coagulation
IEA biological_process
GO:0008289 lipid binding
IEA molecular_function
GO:0010575 positive regulation of va
scular endothelial growth
factor production
IDA biological_process
GO:0010828 positive regulation of gl
ucose transport
IDA biological_process
GO:0010828 positive regulation of gl
ucose transport
IDA biological_process
GO:0010866 regulation of triglycerid
e biosynthetic process
IDA biological_process
GO:0010884 positive regulation of li
pid storage
IDA biological_process
GO:0010951 negative regulation of en
dopeptidase activity
IEA biological_process
GO:0030449 regulation of complement
activation
TAS biological_process
GO:0031715 C5L2 anaphylatoxin chemot
actic receptor binding
IDA molecular_function
GO:0032026 response to magnesium ion
IEA biological_process
GO:0032355 response to estradiol
IEA biological_process
GO:0032570 response to progesterone
IEA biological_process
GO:0045745 positive regulation of G-
protein coupled receptor
protein signaling pathway
IDA biological_process
GO:0045766 positive regulation of an
giogenesis
IEA biological_process
GO:0048037 cofactor binding
IEA molecular_function
GO:0048639 positive regulation of de
velopmental growth
IEA biological_process
GO:0050776 regulation of immune resp
onse
TAS biological_process
GO:0051384 response to glucocorticoi
d
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IEA biological_process
GO:0072562 blood microparticle
IDA cellular_component
GO:2000427 positive regulation of ap
optotic cell clearance
IMP biological_process
GO:0001798 positive regulation of ty
pe IIa hypersensitivity
IEA biological_process
GO:0001934 positive regulation of pr
otein phosphorylation
IDA biological_process
GO:0001970 positive regulation of ac
tivation of membrane atta
ck complex
IEA biological_process
GO:0002376 immune system process
IEA biological_process
GO:0002507 tolerance induction
IEA biological_process
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0004866 endopeptidase inhibitor a
ctivity
IEA molecular_function
GO:0005102 receptor binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0006508 proteolysis
IEA biological_process
GO:0006629 lipid metabolic process
IEA biological_process
GO:0006631 fatty acid metabolic proc
ess
IEA biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0006954 inflammatory response
IEA biological_process
GO:0006955 immune response
TAS biological_process
GO:0006956 complement activation
IEA biological_process
GO:0006956 complement activation
IEA biological_process
GO:0006956 complement activation
IMP biological_process
GO:0006956 complement activation
TAS biological_process
GO:0006957 complement activation, al
ternative pathway
IEA biological_process
GO:0006957 complement activation, al
ternative pathway
TAS biological_process
GO:0006958 complement activation, cl
assical pathway
IEA biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological_process
GO:0007596 blood coagulation
IEA biological_process
GO:0008289 lipid binding
IEA molecular_function
GO:0010575 positive regulation of va
scular endothelial growth
factor production
IDA biological_process
GO:0010828 positive regulation of gl
ucose transport
IDA biological_process
GO:0010828 positive regulation of gl
ucose transport
IDA biological_process
GO:0010866 regulation of triglycerid
e biosynthetic process
IDA biological_process
GO:0010884 positive regulation of li
pid storage
IDA biological_process
GO:0010951 negative regulation of en
dopeptidase activity
IEA biological_process
GO:0030449 regulation of complement
activation
TAS biological_process
GO:0031715 C5L2 anaphylatoxin chemot
actic receptor binding
IDA molecular_function
GO:0032026 response to magnesium ion
IEA biological_process
GO:0032355 response to estradiol
IEA biological_process
GO:0032570 response to progesterone
IEA biological_process
GO:0043627 response to estrogen
IEA biological_process
GO:0045087 innate immune response
IEA biological_process
GO:0045745 positive regulation of G-
protein coupled receptor
protein signaling pathway
IDA biological_process
GO:0045766 positive regulation of an
giogenesis
IEA biological_process
GO:0048037 cofactor binding
IEA molecular_function
GO:0048639 positive regulation of de
velopmental growth
IEA biological_process
GO:0050766 positive regulation of ph
agocytosis
IEA biological_process
GO:0050776 regulation of immune resp
onse
TAS biological_process
GO:0051384 response to glucocorticoi
d
IEA biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IEA biological_process
GO:0072562 blood microparticle
IDA cellular_component
GO:2000427 positive regulation of ap
optotic cell clearance
IMP biological_process
GO:0001934 positive regulation of pr
otein phosphorylation
IDA biological_process
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0004252 serine-type endopeptidase
activity
TAS molecular_function
GO:0005102 receptor binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0006955 immune response
TAS biological_process
GO:0006956 complement activation
IMP biological_process
GO:0006956 complement activation
TAS biological_process
GO:0006957 complement activation, al
ternative pathway
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
TAS biological_process
GO:0010575 positive regulation of va
scular endothelial growth
factor production
IDA biological_process
GO:0010828 positive regulation of gl
ucose transport
IDA biological_process
GO:0010828 positive regulation of gl
ucose transport
IDA biological_process
GO:0010866 regulation of triglycerid
e biosynthetic process
IDA biological_process
GO:0010884 positive regulation of li
pid storage
IDA biological_process
GO:0030449 regulation of complement
activation
TAS biological_process
GO:0031715 C5L2 anaphylatoxin chemot
actic receptor binding
IDA molecular_function
GO:0045745 positive regulation of G-
protein coupled receptor
protein signaling pathway
IDA biological_process
GO:0050776 regulation of immune resp
onse
TAS biological_process
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0072562 blood microparticle
IDA cellular_component
GO:2000427 positive regulation of ap
optotic cell clearance
IMP biological_process

KEGG pathways

hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05203  Viral carcinogenesis
hsa05142  Chagas disease
hsa04145  Phagosome
hsa05140  Leishmaniasis
hsa05133  Pertussis
hsa04610  Complement and coagulation cascades
hsa05134  Legionellosis
hsa05322  Systemic lupus erythematosus
hsa05150  Staphylococcus aureus infection

Diseases

Associated diseases References
Alzheimer's disease PMID: 15648851
Asthma PMID: 15278436
Atypical hemolytic uremic syndrome KEGG: H01434
Cirrhosis PMID: 4029969
Endometriosis PMID: 2332059
Follicular development PMID: 25595538
Hypertrophy PMID: 8395174
Inflammatory bowel disease PMID: 16570073
Macular degeneration PMID: 17634448, KEGG: H00821
Male infertility PMID: 26791536
Ovarian endometriosis PMID: 22633261
Ovarian hyperstimulation syndrome (OHSS) PMID: 21697218
Polycystic ovary syndrome (PCOS) PMID: 18206145
Systemic lupus erythematosus PMID: 11801636
Endometriosis INFBASE27137486
Ovarian�endometriosis INFBASE22633261
Endometriosis associated infertility INFBASE19263878
Female infertility INFBASE6208058

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
2332059 Endometrio
sis



Show abstract
9102363 Endometrio
sis


AMY1
AMY2
ACP1
PGM1
SOD-A
ESD
GLO1
C3
TF
PGM1
Show abstract
21733505 Endometrio
sis
Puerto
Rican
384 (147 contro
ls without endo
metriosis or in
fertility, 214
subjects with
endometriosis,
with or without
infertility, 7
2 subjects with
endometriosis
without known i
nfertility prob
lems, 73 subjec
ts with endomet
riosis-associat
ed infertility)
Female infertility LOXL4
C3
Show abstract
22633261 Endometrio
sis (ovari
an)



Show abstract
6208058 Endometrio
sis

102 patients wi
th Wright's-Gie
msa and Papanic
olaou stains
PGF2 alpha
PGE2
C3c
C4
Show abstract
9102363 Endometrio
sis


AMY1
AMY2
ACP1
PGM1
SOD-A
ESD
GLO1
C3
TF
PGM1
Show abstract
19263878 Endometrio
sis

52 (26 fertile
women, 26 infer
tile ones)
Female infertility TF
C3serum amyloid P-component
alpha-1-antitrypsin and clusterin
Show abstract
27137486 Endometrio
sis

23 (20 endometr
iosis patients,
3 healthy cont
rols)
AZGP1
C3
Show abstract