Endometriosis Knowledgebase

Search Result

Gene id

6696

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SPP1 Gene UCSC Ensembl

Aliases

BNSP, BSPI, ETA-1, OPN

Gene name

secreted phosphoprotein 1

Alternate names

osteopontin, SPP1/CALPHA1 fusion, early T-lymphocyte activation 1, nephropontin, osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein, secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1), secret,

Gene location

4q22.1 (87975649: 87983410) Exons: 8 NC_000004.12

Gene summary(Entrez)

The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

OMIM

166490

Protein Summary

Protein general information

P10451

Name: Osteopontin (Bone sialoprotein 1) (Nephropontin) (Secreted phosphoprotein 1) (SPP 1) (Urinary stone protein) (Uropontin)

Length: 314 Mass: 35,423

Tissue specificity: Bone. Found in plasma.

Sequence

MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLP
SKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVV
PTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSY
ETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF
RISHELDSASSEVN

Structural information

Motifs	Cell attachment(159-161)
Interpro:	IPR002038 IPR019841
Prosite:	PS00884
Pfam:	PF00865
PDB:	3CXD 3DSF
PDBsum:	3CXD 3DSF
DIP:	49933
MINT:	1380527
STRING:	ENSP00000378517;

Other Databases

GeneCards: SPP1; Malacards: SPP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001649	osteoblast differentiatio n	IBA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0007155	cell adhesion	IBA	biological_process
GO:0007566	embryo implantation	TAS	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031214	biomineral tissue develop ment	IEA	biological_process
GO:0033280	response to vitamin D	IDA	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0045780	positive regulation of bo ne resorption	IBA	biological_process
GO:0046697	decidualization	TAS	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048545	response to steroid hormo ne	IEA	biological_process
GO:0048685	negative regulation of co llateral sprouting of int act axon in response to i njury	IEA	biological_process
GO:0050840	extracellular matrix bind ing	IBA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0001503	ossification	IEA	biological_process
GO:0001649	osteoblast differentiatio n	IEA	biological_process
GO:0001649	osteoblast differentiatio n	IBA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IBA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007566	embryo implantation	TAS	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031214	biomineral tissue develop ment	IEA	biological_process
GO:0033280	response to vitamin D	IDA	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0045780	positive regulation of bo ne resorption	IEA	biological_process
GO:0045780	positive regulation of bo ne resorption	IBA	biological_process
GO:0046697	decidualization	TAS	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048545	response to steroid hormo ne	IEA	biological_process
GO:0048685	negative regulation of co llateral sprouting of int act axon in response to i njury	IEA	biological_process
GO:0050840	extracellular matrix bind ing	IBA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0001649	osteoblast differentiatio n	IBA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0007155	cell adhesion	IBA	biological_process
GO:0007566	embryo implantation	TAS	biological_process
GO:0022617	extracellular matrix disa ssembly	TAS	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0033280	response to vitamin D	IDA	biological_process
GO:0045780	positive regulation of bo ne resorption	IBA	biological_process
GO:0046697	decidualization	TAS	biological_process
GO:0050840	extracellular matrix bind ing	IBA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04620  Toll-like receptor signaling pathway
hsa04371  Apelin signaling pathway
hsa04512  ECM-receptor interaction

Diseases

Associated diseases	References
Adenomyosis	PMID: 24021319
Aortic aneurysm	PMID: 15167446
Asthma	PMID: 16433860
Atherosclerosis	PMID: 18317949
Autoimmune diseases	PMID: 14592838
Cancer	PMID: 17496055
Deep infiltrating endometriosis (DIE), Focal adenomyosis	PMID: 27678100
Ectopic endometrium of adenomyosis	PMID: 19573311
Endometrial defects in adenomyosis	PMID: 24021319
Endometriosis	PMID: 18672236
Female infertility	PMID: 22999554
Endometriosis associated infertility	INFBASE22215628
Endometriosis	INFBASE17081533
Multiple sclerosis	PMID: 15885319
Nephrolithiasis	PMID: 17519954
Periodontitis	PMID: 16512757
Polycystic ovary syndrome (PCOS)	PMID: 26701868
Primary unexplained infertility	PMID: 18353318
Rheumatoid arthritis	PMID: 15742429
Sarcoidosis	PMID: 15004750
Systemic lupus erythematosus	PMID: 15692970

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
22215628	Endometrio sis	60 (20 infertil e patients with Stage I or II endometriosis a s the only dete ctable cause of infertility, 2 0 infertile pat ients with unex plained inferti lity, 20 fertil e women undergo ing tubal steri lization)	Female infertility	OPN integrin	Show abstract
19260859	Endometrio sis	122 (79 patient s with histolog ically confirme d endometriosis , 43 patients w ithout endometr iosis)	Female infertility		Show abstract
22147918	Endometrio sis	73 (35 fertile women without e ndometriosis, 3 8 women with su rgically diagno sed endometrios is)		S100P S100A4 osteopontin (OPN) or anterior gradient homologue 2 (AGR2)	Show abstract
17081533	Endometrio sis	73 (35 fertile women without e ndometriosis, 3 8 women with su rgically diagno sed endometrios is)		S100P AGR2 and OPN	Show abstract
23545719	Endometrio sis	59 (31 women wi th endometriosi s, 28 healthy c ontrol subjects )		OPN CD133	Show abstract
18672236	Endometrio sis	47 (24 women wi th endometriosi s, 23 healthy v olunteers of si milar age)		GdA OPN LPA3 HOXA10	Show abstract