Endometriosis Knowledgebase

Search Result

Gene id

6352

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CCL5 Gene UCSC Ensembl

Aliases

D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP

Gene name

C-C motif chemokine ligand 5

Alternate names

C-C motif chemokine 5, T-cell specific protein p288, beta-chemokine RANTES, chemokine (C-C motif) ligand 5, eosinophil chemotactic cytokine, regulated upon activation, normally T-expressed, and presumably secreted, small inducible cytokine subfamily A (Cys-Cys),

Gene location

17q12 (35880372: 35871490) Exons: 4 NC_000017.11

Gene summary(Entrez)

This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]

OMIM

187011

SNPs

rs2107538

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000679.2   g.35880776C>T
NC_000017.10   g.34207780C>T
NC_000017.11   g.35880776C>T
NG_015990.1   g.4598G>A
NM_001278736.1   c.-471G>A
NM_002985.2   c.-471G>A
NT_187614.1   g.115308C>T
NW_004166864.2   g.172944C>T
XR_001752852.1   n.426+702C>T
XR_001756367.1   n.426+702C>T
XR_934696.2   n.91-3606C>T
XR_934697.2   n.91-3606C>T
XR_951963.2   n.91-3606C>T
XR_951964.2   n.91-3606C>T
rs2280788

Strand:    Allele origin:   Allele change: C/G   Mutation type: snp

CM000679.2   g.35880401G>C
NC_000017.10   g.34207405G>C
NC_000017.11   g.35880401G>C
NG_015990.1   g.4973C>G
NM_001278736.1   c.-96C>G
NM_002985.2   c.-96C>G
NT_187614.1   g.114933G>C
NW_004166864.2   g.172569G>C
XR_001752852.1   n.426+327G>C
XR_001756367.1   n.426+327G>C
XR_934696.2   n.91-3981G>C
XR_934697.2   n.91-3981G>C
XR_951963.2   n.91-3981G>C
XR_951964.2   n.91-3981G>C

Protein Summary

Protein general information

P13501

Name: C C motif chemokine 5 (EoCP) (Eosinophil chemotactic cytokine) (SIS delta) (Small inducible cytokine A5) (T cell specific protein P228) (TCP228) (T cell specific protein RANTES) [Cleaved into: RANTES(3 68); RANTES(4 68)]

Length: 91 Mass: 9,990

Tissue specificity: Expressed in the follicular fluid (at protein level). T-cell and macrophage specific. {ECO

Sequence

MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCAN
PEKKWVREYINSLEMS

Structural information

Interpro:	IPR030595 IPR000827 IPR001811
Prosite:	PS00472
Pfam:	PF00048
PDB:	1B3A 1EQT 1HRJ 1RTN 1RTO 1U4L 1U4M 1U4P 1U4R 2L9H 2VXW 5CMD 5COY 5DNF
PDBsum:	1B3A 1EQT 1HRJ 1RTN 1RTO 1U4L 1U4M 1U4P 1U4R 2L9H 2VXW 5CMD 5COY 5DNF
DIP:	31
MINT:	103226
STRING:	ENSP00000293272;

Other Databases

GeneCards: CCL5; Malacards: CCL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	IMP	biological_process
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0002544	chronic inflammatory resp onse	IEA	biological_process
GO:0002548	monocyte chemotaxis	IC	biological_process
GO:0002676	regulation of chronic inf lammatory response	TAS	biological_process
GO:0004435	phosphatidylinositol phos pholipase C activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006816	calcium ion transport	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006887	exocytosis	IDA	biological_process
GO:0006935	chemotaxis	NAS	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007267	cell-cell signaling	IDA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008009	chemokine activity	IDA	molecular_function
GO:0008009	chemokine activity	NAS	molecular_function
GO:0008201	heparin binding	IEA	molecular_function
GO:0009615	response to virus	TAS	biological_process
GO:0009636	response to toxic substan ce	IDA	biological_process
GO:0009651	response to salt stress	IEA	biological_process
GO:0010535	positive regulation of ac tivation of JAK2 kinase a ctivity	TAS	biological_process
GO:0010759	positive regulation of ma crophage chemotaxis	IDA	biological_process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological_process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological_process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological_process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0016004	phospholipase activator a ctivity	IDA	molecular_function
GO:0018894	dibenzo-p-dioxin metaboli c process	IEA	biological_process
GO:0030298	receptor signaling protei n tyrosine kinase activat or activity	IDA	molecular_function
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0031328	positive regulation of ce llular biosynthetic proce ss	IDA	biological_process
GO:0031584	activation of phospholipa se D activity	IDA	biological_process
GO:0031622	positive regulation of fe ver generation	IEA	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IDA	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	TAS	molecular_function
GO:0031729	CCR4 chemokine receptor b inding	TAS	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IPI	molecular_function
GO:0032868	response to insulin	IEA	biological_process
GO:0033634	positive regulation of ce ll-cell adhesion mediated by integrin	IDA	biological_process
GO:0034112	positive regulation of ho motypic cell-cell adhesio n	IDA	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042119	neutrophil activation	IDA	biological_process
GO:0042327	positive regulation of ph osphorylation	IDA	biological_process
GO:0042379	chemokine receptor bindin g	IPI	molecular_function
GO:0042379	chemokine receptor bindin g	IPI	molecular_function
GO:0042493	response to drug	IEA	biological_process
GO:0042531	positive regulation of ty rosine phosphorylation of STAT protein	IDA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0043621	protein self-association	IDA	molecular_function
GO:0043623	cellular protein complex assembly	IDA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0043922	negative regulation by ho st of viral transcription	IDA	biological_process
GO:0044344	cellular response to fibr oblast growth factor stim ulus	IEP	biological_process
GO:0045070	positive regulation of vi ral genome replication	TAS	biological_process
GO:0045071	negative regulation of vi ral genome replication	IDA	biological_process
GO:0045089	positive regulation of in nate immune response	TAS	biological_process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IEA	biological_process
GO:0045744	negative regulation of G- protein coupled receptor protein signaling pathway	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045785	positive regulation of ce ll adhesion	IDA	biological_process
GO:0045948	positive regulation of tr anslational initiation	NAS	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	TAS	biological_process
GO:0046817	chemokine receptor antago nist activity	IDA	molecular_function
GO:0048245	eosinophil chemotaxis	IDA	biological_process
GO:0048246	macrophage chemotaxis	TAS	biological_process
GO:0048247	lymphocyte chemotaxis	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IBA	biological_process
GO:0050796	regulation of insulin sec retion	IDA	biological_process
GO:0050863	regulation of T cell acti vation	IDA	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0051262	protein tetramerization	IDA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IDA	biological_process
GO:0060754	positive regulation of ma st cell chemotaxis	IEA	biological_process
GO:0061098	positive regulation of pr otein tyrosine kinase act ivity	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IDA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	TAS	biological_process
GO:0070100	negative regulation of ch emokine-mediated signalin g pathway	IEA	biological_process
GO:0070233	negative regulation of T cell apoptotic process	IDA	biological_process
GO:0070234	positive regulation of T cell apoptotic process	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0070723	response to cholesterol	IEA	biological_process
GO:0071230	cellular response to amin o acid stimulus	IEA	biological_process
GO:0071307	cellular response to vita min K	IEA	biological_process
GO:0071315	cellular response to morp hine	IEA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IEP	biological_process
GO:0071347	cellular response to inte rleukin-1	IEP	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEP	biological_process
GO:0071361	cellular response to etha nol	IEA	biological_process
GO:0071403	cellular response to high density lipoprotein part icle stimulus	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:0071448	cellular response to alky l hydroperoxide	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:1901214	regulation of neuron deat h	IDA	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:2000110	negative regulation of ma crophage apoptotic proces s	IEA	biological_process
GO:2000406	positive regulation of T cell migration	IDA	biological_process
GO:2000503	positive regulation of na tural killer cell chemota xis	IDA	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0002544	chronic inflammatory resp onse	IEA	biological_process
GO:0002548	monocyte chemotaxis	IC	biological_process
GO:0002676	regulation of chronic inf lammatory response	TAS	biological_process
GO:0004435	phosphatidylinositol phos pholipase C activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006816	calcium ion transport	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006887	exocytosis	IDA	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	NAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007267	cell-cell signaling	IDA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	IDA	molecular_function
GO:0008009	chemokine activity	NAS	molecular_function
GO:0008201	heparin binding	IEA	molecular_function
GO:0009615	response to virus	IEA	biological_process
GO:0009615	response to virus	IEA	biological_process
GO:0009615	response to virus	TAS	biological_process
GO:0009617	response to bacterium	IEA	biological_process
GO:0009636	response to toxic substan ce	IDA	biological_process
GO:0009651	response to salt stress	IEA	biological_process
GO:0010535	positive regulation of ac tivation of JAK2 kinase a ctivity	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010759	positive regulation of ma crophage chemotaxis	IDA	biological_process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological_process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological_process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological_process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0016004	phospholipase activator a ctivity	IDA	molecular_function
GO:0018894	dibenzo-p-dioxin metaboli c process	IEA	biological_process
GO:0030298	receptor signaling protei n tyrosine kinase activat or activity	IDA	molecular_function
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0031328	positive regulation of ce llular biosynthetic proce ss	IDA	biological_process
GO:0031584	activation of phospholipa se D activity	IDA	biological_process
GO:0031622	positive regulation of fe ver generation	IEA	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0031667	response to nutrient leve ls	IEA	biological_process
GO:0031726	CCR1 chemokine receptor b inding	IEA	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IEA	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IDA	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	TAS	molecular_function
GO:0031729	CCR4 chemokine receptor b inding	IEA	molecular_function
GO:0031729	CCR4 chemokine receptor b inding	TAS	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IEA	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IPI	molecular_function
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0033634	positive regulation of ce ll-cell adhesion mediated by integrin	IDA	biological_process
GO:0034097	response to cytokine	IEA	biological_process
GO:0034112	positive regulation of ho motypic cell-cell adhesio n	IDA	biological_process
GO:0034612	response to tumor necrosi s factor	IEA	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042119	neutrophil activation	IDA	biological_process
GO:0042327	positive regulation of ph osphorylation	IDA	biological_process
GO:0042379	chemokine receptor bindin g	IPI	molecular_function
GO:0042379	chemokine receptor bindin g	IPI	molecular_function
GO:0042493	response to drug	IEA	biological_process
GO:0042531	positive regulation of ty rosine phosphorylation of STAT protein	IDA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0043621	protein self-association	IDA	molecular_function
GO:0043623	cellular protein complex assembly	IDA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0043922	negative regulation by ho st of viral transcription	IDA	biological_process
GO:0044344	cellular response to fibr oblast growth factor stim ulus	IEP	biological_process
GO:0045070	positive regulation of vi ral genome replication	TAS	biological_process
GO:0045071	negative regulation of vi ral genome replication	IDA	biological_process
GO:0045089	positive regulation of in nate immune response	TAS	biological_process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IEA	biological_process
GO:0045744	negative regulation of G- protein coupled receptor protein signaling pathway	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045785	positive regulation of ce ll adhesion	IDA	biological_process
GO:0045948	positive regulation of tr anslational initiation	NAS	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	TAS	biological_process
GO:0046817	chemokine receptor antago nist activity	IDA	molecular_function
GO:0048245	eosinophil chemotaxis	IDA	biological_process
GO:0048246	macrophage chemotaxis	TAS	biological_process
GO:0048247	lymphocyte chemotaxis	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IBA	biological_process
GO:0050796	regulation of insulin sec retion	IDA	biological_process
GO:0050863	regulation of T cell acti vation	IDA	biological_process
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0051262	protein tetramerization	IDA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IDA	biological_process
GO:0060548	negative regulation of ce ll death	IEA	biological_process
GO:0060754	positive regulation of ma st cell chemotaxis	IEA	biological_process
GO:0061098	positive regulation of pr otein tyrosine kinase act ivity	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IDA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	TAS	biological_process
GO:0070100	negative regulation of ch emokine-mediated signalin g pathway	IEA	biological_process
GO:0070233	negative regulation of T cell apoptotic process	IDA	biological_process
GO:0070234	positive regulation of T cell apoptotic process	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0070723	response to cholesterol	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071230	cellular response to amin o acid stimulus	IEA	biological_process
GO:0071307	cellular response to vita min K	IEA	biological_process
GO:0071315	cellular response to morp hine	IEA	biological_process
GO:0071345	cellular response to cyto kine stimulus	IEA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IEP	biological_process
GO:0071347	cellular response to inte rleukin-1	IEP	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEP	biological_process
GO:0071361	cellular response to etha nol	IEA	biological_process
GO:0071396	cellular response to lipi d	IEA	biological_process
GO:0071403	cellular response to high density lipoprotein part icle stimulus	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:0071448	cellular response to alky l hydroperoxide	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:0090026	positive regulation of mo nocyte chemotaxis	IEA	biological_process
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:1901214	regulation of neuron deat h	IDA	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:2000110	negative regulation of ma crophage apoptotic proces s	IEA	biological_process
GO:2000406	positive regulation of T cell migration	IDA	biological_process
GO:2000503	positive regulation of na tural killer cell chemota xis	IDA	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0002548	monocyte chemotaxis	IC	biological_process
GO:0002676	regulation of chronic inf lammatory response	TAS	biological_process
GO:0004435	phosphatidylinositol phos pholipase C activity	IDA	molecular_function
GO:0004672	protein kinase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006816	calcium ion transport	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006887	exocytosis	IDA	biological_process
GO:0006935	chemotaxis	NAS	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007267	cell-cell signaling	IDA	biological_process
GO:0008009	chemokine activity	IDA	molecular_function
GO:0008009	chemokine activity	NAS	molecular_function
GO:0009615	response to virus	TAS	biological_process
GO:0009636	response to toxic substan ce	IDA	biological_process
GO:0010535	positive regulation of ac tivation of JAK2 kinase a ctivity	TAS	biological_process
GO:0010759	positive regulation of ma crophage chemotaxis	IDA	biological_process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological_process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological_process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological_process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0016004	phospholipase activator a ctivity	IDA	molecular_function
GO:0030298	receptor signaling protei n tyrosine kinase activat or activity	IDA	molecular_function
GO:0030335	positive regulation of ce ll migration	IDA	biological_process
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0031328	positive regulation of ce llular biosynthetic proce ss	IDA	biological_process
GO:0031584	activation of phospholipa se D activity	IDA	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IDA	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	IPI	molecular_function
GO:0031726	CCR1 chemokine receptor b inding	TAS	molecular_function
GO:0031729	CCR4 chemokine receptor b inding	TAS	molecular_function
GO:0031730	CCR5 chemokine receptor b inding	IPI	molecular_function
GO:0033634	positive regulation of ce ll-cell adhesion mediated by integrin	IDA	biological_process
GO:0034112	positive regulation of ho motypic cell-cell adhesio n	IDA	biological_process
GO:0042056	chemoattractant activity	IDA	molecular_function
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042119	neutrophil activation	IDA	biological_process
GO:0042327	positive regulation of ph osphorylation	IDA	biological_process
GO:0042379	chemokine receptor bindin g	IPI	molecular_function
GO:0042379	chemokine receptor bindin g	IPI	molecular_function
GO:0042531	positive regulation of ty rosine phosphorylation of STAT protein	IDA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043547	positive regulation of GT Pase activity	IBA	biological_process
GO:0043621	protein self-association	IDA	molecular_function
GO:0043623	cellular protein complex assembly	IDA	biological_process
GO:0043922	negative regulation by ho st of viral transcription	IDA	biological_process
GO:0044344	cellular response to fibr oblast growth factor stim ulus	IEP	biological_process
GO:0045070	positive regulation of vi ral genome replication	TAS	biological_process
GO:0045071	negative regulation of vi ral genome replication	IDA	biological_process
GO:0045089	positive regulation of in nate immune response	TAS	biological_process
GO:0045744	negative regulation of G- protein coupled receptor protein signaling pathway	IDA	biological_process
GO:0045785	positive regulation of ce ll adhesion	IDA	biological_process
GO:0045948	positive regulation of tr anslational initiation	NAS	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	TAS	biological_process
GO:0046817	chemokine receptor antago nist activity	IDA	molecular_function
GO:0048245	eosinophil chemotaxis	IDA	biological_process
GO:0048246	macrophage chemotaxis	TAS	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050729	positive regulation of in flammatory response	IBA	biological_process
GO:0050796	regulation of insulin sec retion	IDA	biological_process
GO:0050863	regulation of T cell acti vation	IDA	biological_process
GO:0051262	protein tetramerization	IDA	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IDA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IDA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	TAS	biological_process
GO:0070233	negative regulation of T cell apoptotic process	IDA	biological_process
GO:0070234	positive regulation of T cell apoptotic process	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IBA	biological_process
GO:0071346	cellular response to inte rferon-gamma	IEP	biological_process
GO:0071347	cellular response to inte rleukin-1	IEP	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEP	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:1901214	regulation of neuron deat h	IDA	biological_process
GO:2000406	positive regulation of T cell migration	IDA	biological_process
GO:2000503	positive regulation of na tural killer cell chemota xis	IDA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa05168  Herpes simplex infection
hsa04062  Chemokine signaling pathway
hsa05164  Influenza A
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05142  Chagas disease
hsa05323  Rheumatoid arthritis
hsa04620  Toll-like receptor signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05020  Prion diseases
hsa04623  Cytosolic DNA-sensing pathway

Diseases

Associated diseases	References
Albuminuria	PMID: 18217191
Allergic rhinitis	KEGG: H01360
Alzheimer's disease	PMID: 15488313
Asthma	PMID: 11544456
Atherosclerosis	PMID: 15302103
Behcet's disease	PMID: 14651522
Cancer	PMID: 18306985
Celiac disease	PMID: 16078996
Chronic obstructive pulmonary disease (COPD)	PMID: 16864713
Dermatitis	PMID: 17117952
Diabetes	PMID: 17728497
Endometriosis	PMID: 12837926
Endometriosis	PMID: 11160842
Immune infertility	PMID: 11076090
Inflammation	PMID: 17989610
Multiple sclerosis	PMID: 15471370
Nephropathy	PMID: 12610055
Periodontitis	PMID: 17305874
Sarcoidosis	PMID: 11844139
Sclerosis	PMID: 17599774
Tubal infertility	INFBASE16997300
Female infertility	INFBASE11160842
Endometriosis	INFBASE7505529
Systemic lupus erythematosus	PMID: 15468376
Uveitis	PMID: 17417600
Wegener granulomatosis	PMID: 12858455

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23474119	Endometrio sis	MCP-1, RANTES and MCP-3		95 (54 endometr iosis, 41 contr ols)	Female infertility		Show abstract
16997300	Endometrio sis			60 (32 women wi th endometriosi s stages I-IV, 28 women withou t endometriosis )		RANTES MCP-1	Show abstract
9141560	Endometrio sis						Show abstract
17678915	Endometrio sis			35 (20 during l uteal phase, 15 during menustr ual phase were selected for th is study based on cycle phase and presence/ab sence of endome triosis )		alpha(V) integrin IL-1 beta MCP-1 RANTES VCAM-1	Show abstract
20732991	Endometrio sis					RANTES	Show abstract
12837926	Endometrio sis	RANTES (-403G-->A, -28C-->G)	Spanish			RANTES	Show abstract
23219091	Endometrio sis					RANTES CCR1	Show abstract
20617440	Endometrio sis			20 (12 with end ometriosis(ePF) , 8 controls wi thout endometri osis (cPF))		RANTES	Show abstract
7505529	Endometrio sis			36 (12 women wi thout evidence of endometriosi s (controls), 1 2 with mild, an d 12 with moder ate to severe e ndometriosis)	Female infertility	RANTES	Show abstract
11160842	Endometrio sis				Female infertility	RANTES receptors CCR-1 and CCR-5	Show abstract