Endometriosis Knowledgebase

Search Result

Gene id

6286

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

S100P Gene UCSC Ensembl

Aliases

MIG9

Gene name

S100 calcium binding protein P

Alternate names

protein S100-P, migration-inducing gene 9 protein, protein S100-E,

Gene location

4p16.1 (6693838: 6697169) Exons: 2 NC_000004.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. [provided by RefSeq, Jul 2008]

OMIM

600614

Protein Summary

Protein general information

P25815

Name: Protein S100 P (Migration inducing gene 9 protein) (MIG9) (Protein S100 E) (S100 calcium binding protein P)

Length: 95 Mass: 10,400

Tissue specificity: Detected in all of the tissues except brain, testis and small intestine, expression level is higher in placenta, heart, lung, skeletal muscle, spleen and leukocyte. Up-regulated in various pancreatic ductal adenocarcinomas and pancreat

Sequence

MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFI
VFVAAITSACHKYFEKAGLK

Structural information

Protein Domains	EF-hand (12-47) EF-hand (49-84)
Interpro:	IPR011992 IPR002048 IPR034325 IPR001751 IPR013787 IPR028494
Prosite:	PS50222 PS00303
Pfam:	PF01023
CDD:	cd00213
PDB:	1J55 1OZO 2MJW
PDBsum:	1J55 1OZO 2MJW
MINT:	239013
STRING:	ENSP00000296370;

Other Databases

GeneCards: S100P; Malacards: S100P

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000287	magnesium ion binding	TAS	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0010033	response to organic subst ance	IEP	biological_process
GO:0031528	microvillus membrane	IEA	cellular_component
GO:0043542	endothelial cell migratio n	IMP	biological_process
GO:0048306	calcium-dependent protein binding	IPI	molecular_function
GO:0050786	RAGE receptor binding	IEA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0000287	magnesium ion binding	TAS	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005509	calcium ion binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0010033	response to organic subst ance	IEP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0031528	microvillus membrane	IEA	cellular_component
GO:0042995	cell projection	IEA	cellular_component
GO:0043542	endothelial cell migratio n	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048306	calcium-dependent protein binding	IPI	molecular_function
GO:0050786	RAGE receptor binding	IEA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0000287	magnesium ion binding	TAS	molecular_function
GO:0005509	calcium ion binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0010033	response to organic subst ance	IEP	biological_process
GO:0043542	endothelial cell migratio n	IMP	biological_process
GO:0048306	calcium-dependent protein binding	IPI	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

Diseases

Associated diseases	References
Endometrial cancer	PMID: 24966918
Endometriosis	PMID: 26148093
Endometriosis	INFBASE22147918
Endometriosis	INFBASE17081533

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22147918	Endometrio sis			73 (35 fertile women without e ndometriosis, 3 8 women with su rgically diagno sed endometrios is)		S100P S100A4 osteopontin (OPN) or anterior gradient homologue 2 (AGR2)	Show abstract
17081533	Endometrio sis			73 (35 fertile women without e ndometriosis, 3 8 women with su rgically diagno sed endometrios is)		S100P AGR2 and OPN	Show abstract