Endometriosis Knowledgebase

Search Result

Gene id

5730

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PTGDS Gene UCSC Ensembl

Aliases

L-PGDS, LPGDS, PDS, PGD2, PGDS, PGDS2

Gene name

prostaglandin D2 synthase

Alternate names

prostaglandin-H2 D-isomerase, PGD2 synthase, beta-trace protein, cerebrin-28, glutathione-independent PGD synthase, glutathione-independent PGD synthetase, lipocalin-type prostaglandin D synthase, prostaglandin D synthase, prostaglandin D2 synthase 21kDa (brain), ,

Gene location

9q34.3 (136977503: 136981741) Exons: 7 NC_000009.12

Gene summary(Entrez)

The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. This gene is preferentially expressed in brain. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement sleep. [provided by RefSeq, Jul 2008]

OMIM

176803

Protein Summary

Protein general information

P41222

Name: Prostaglandin H2 D isomerase (EC 5.3.99.2) (Beta trace protein) (Cerebrin 28) (Glutathione independent PGD synthase) (Lipocalin type prostaglandin D synthase) (Prostaglandin D2 synthase) (PGD2 synthase) (PGDS) (PGDS2)

Length: 190 Mass: 21,029

Tissue specificity: Abundant in the brain and CNS, where it is expressed in tissues of the blood-brain barrier and secreted into the cerebro-spinal fluid. Abundantly expressed in the heart. In the male reproductive system, it is expressed in the testis, e

Sequence

MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVAPATDG
GLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYS
RTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQ

Structural information

Interpro:	IPR012674 IPR002345 IPR022272 IPR000566 IPR002972
Prosite:	PS00213
Pfam:	PF00061
PDB:	2WWP 3O19 3O22 3O2Y 4IMN 4IMO 4ORR 4ORS 4ORU 4ORW 4ORX 4ORY 4OS0 4OS3 4OS8 5WY9
PDBsum:	2WWP 3O19 3O22 3O2Y 4IMN 4IMO 4ORR 4ORS 4ORU 4ORW 4ORX 4ORY 4OS0 4OS3 4OS8 5WY9
MINT:	2862256
STRING:	ENSP00000360687;

Other Databases

GeneCards: PTGDS; Malacards: PTGDS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001516	prostaglandin biosyntheti c process	ISS	biological_process
GO:0001516	prostaglandin biosyntheti c process	IDA	biological_process
GO:0004667	prostaglandin-D synthase activity	ISS	molecular_function
GO:0004667	prostaglandin-D synthase activity	IDA	molecular_function
GO:0004667	prostaglandin-D synthase activity	TAS	molecular_function
GO:0005215	transporter activity	ISS	molecular_function
GO:0005501	retinoid binding	ISS	molecular_function
GO:0005504	fatty acid binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005791	rough endoplasmic reticul um	IDA	cellular_component
GO:0005794	Golgi apparatus	ISS	cellular_component
GO:0006810	transport	ISS	biological_process
GO:0019371	cyclooxygenase pathway	TAS	biological_process
GO:0031965	nuclear membrane	IEA	cellular_component
GO:0045187	regulation of circadian s leep/wake cycle, sleep	ISS	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2000255	negative regulation of ma le germ cell proliferatio n	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	ISS	biological_process
GO:0001516	prostaglandin biosyntheti c process	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	IDA	biological_process
GO:0004667	prostaglandin-D synthase activity	IEA	molecular_function
GO:0004667	prostaglandin-D synthase activity	IEA	molecular_function
GO:0004667	prostaglandin-D synthase activity	ISS	molecular_function
GO:0004667	prostaglandin-D synthase activity	TAS	molecular_function
GO:0004667	prostaglandin-D synthase activity	IDA	molecular_function
GO:0004667	prostaglandin-D synthase activity	TAS	molecular_function
GO:0005215	transporter activity	IEA	molecular_function
GO:0005215	transporter activity	IEA	molecular_function
GO:0005215	transporter activity	ISS	molecular_function
GO:0005501	retinoid binding	IEA	molecular_function
GO:0005501	retinoid binding	ISS	molecular_function
GO:0005504	fatty acid binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IDA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005791	rough endoplasmic reticul um	IEA	cellular_component
GO:0005791	rough endoplasmic reticul um	IDA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	ISS	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006631	fatty acid metabolic proc ess	IEA	biological_process
GO:0006633	fatty acid biosynthetic p rocess	IEA	biological_process
GO:0006693	prostaglandin metabolic p rocess	IEA	biological_process
GO:0006810	transport	IEA	biological_process
GO:0006810	transport	IEA	biological_process
GO:0006810	transport	ISS	biological_process
GO:0006810	transport	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016853	isomerase activity	IEA	molecular_function
GO:0019371	cyclooxygenase pathway	TAS	biological_process
GO:0031965	nuclear membrane	IEA	cellular_component
GO:0036094	small molecule binding	IEA	molecular_function
GO:0045187	regulation of circadian s leep/wake cycle, sleep	IEA	biological_process
GO:0045187	regulation of circadian s leep/wake cycle, sleep	ISS	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2000255	negative regulation of ma le germ cell proliferatio n	IEA	biological_process
GO:0001516	prostaglandin biosyntheti c process	ISS	biological_process
GO:0001516	prostaglandin biosyntheti c process	IDA	biological_process
GO:0004667	prostaglandin-D synthase activity	ISS	molecular_function
GO:0004667	prostaglandin-D synthase activity	TAS	molecular_function
GO:0004667	prostaglandin-D synthase activity	IDA	molecular_function
GO:0004667	prostaglandin-D synthase activity	TAS	molecular_function
GO:0005215	transporter activity	ISS	molecular_function
GO:0005501	retinoid binding	ISS	molecular_function
GO:0005504	fatty acid binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005791	rough endoplasmic reticul um	IDA	cellular_component
GO:0005794	Golgi apparatus	ISS	cellular_component
GO:0006810	transport	ISS	biological_process
GO:0019371	cyclooxygenase pathway	TAS	biological_process
GO:0045187	regulation of circadian s leep/wake cycle, sleep	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa01100 Metabolic pathways
hsa00590 Arachidonic acid metabolism

Diseases

Associated diseases	References
Endometriosis (ovarian)	PMID: 15005245
Asthma	PMID: 19247692
Azoospermia	PMID: 10096390
Cancer	PMID: 19124506
Carotid atherosclerosis	PMID: 15325247
Chronic kidney failure	PMID: 19578796
Complete androgen insensitivity syndrome (CAIS)	PMID: 19539906
Non-obstructive azoospermia (NOA)	PMID: 15748601
Ovarian endometriosis	INFBASE15005245
Oligozoospermia	PMID: 12090353
Oligozoospermia	PMID: 17367300
Ovarian endometriosis	PMID: 15005245
Ovarian endometriosis	PMID: 15005245
Periodontitis	PMID: 15081423
Schizophrenia	PMID: 17230501

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
15005245	Endometrio sis (ovari an)					FCER1G PGDS IL-8 GRO1 GRO2 CXCR4 MCP1 MMP COL4A2 and COL5A2	Show abstract