Endometriosis Knowledgebase

Search Result

Gene id

563

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

AZGP1 Gene UCSC Ensembl

Aliases

ZA2G, ZAG

Gene name

alpha-2-glycoprotein 1, zinc-binding

Alternate names

zinc-alpha-2-glycoprotein, Alpha-2-glycoprotein, zinc, Zn-alpha2-glycoprotein, testicular tissue protein Li 227, zn-alpha-2-GP, zn-alpha-2-glycoprotein,

Gene location

7q22.1 (99976111: 99966726) Exons: 4 NC_000007.14

OMIM

194460

Protein Summary

Protein general information

P25311

Name: Zinc alpha 2 glycoprotein (Zn alpha 2 GP) (Zn alpha 2 glycoprotein)

Length: 298 Mass: 34,259

Tissue specificity: Blood plasma, seminal plasma, urine, saliva, sweat, epithelial cells of various human glands, liver.

Sequence

MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQPMGLWR
QVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGRFGCEIENNRSSGAFWKYYYDGKDYIEFNKE
IPAWVPFDPAAQITKQKWEAEPVYVQRAKAYLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKKKLKC
LAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS

Structural information

Protein Domains	Ig-like (207-292)
Interpro:	IPR007110 IPR013783 IPR003006 IPR003597 IPR011161 IPR011162 IPR001039
Prosite:	PS50835 PS00290
Pfam:	PF07654 PF00129
PDB:	1T7V 1T7W 1T7X 1T7Y 1T7Z 1T80 1ZAG 3ES6
PDBsum:	1T7V 1T7W 1T7X 1T7Y 1T7Z 1T80 1ZAG 3ES6
STRING:	ENSP00000292401;

Other Databases

GeneCards: AZGP1; Malacards: AZGP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001580	detection of chemical sti mulus involved in sensory perception of bitter tas te	IDA	biological_process
GO:0001895	retina homeostasis	IEP	biological_process
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0002474	antigen processing and pr esentation of peptide ant igen via MHC class I	IEA	biological_process
GO:0003823	antigen binding	IBA	molecular_function
GO:0004540	ribonuclease activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005886	plasma membrane	IBA	cellular_component
GO:0006955	immune response	IEA	biological_process
GO:0007155	cell adhesion	ISS	biological_process
GO:0007155	cell adhesion	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	NAS	biological_process
GO:0008320	protein transmembrane tra nsporter activity	NAS	molecular_function
GO:0019882	antigen processing and pr esentation	IBA	biological_process
GO:0042605	peptide antigen binding	IEA	molecular_function
GO:0042612	MHC class I protein compl ex	IEA	cellular_component
GO:0055085	transmembrane transport	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071806	protein transmembrane tra nsport	IEA	biological_process
GO:0090501	RNA phosphodiester bond h ydrolysis	IEA	biological_process
GO:0001580	detection of chemical sti mulus involved in sensory perception of bitter tas te	IDA	biological_process
GO:0001895	retina homeostasis	IEP	biological_process
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0002474	antigen processing and pr esentation of peptide ant igen via MHC class I	IEA	biological_process
GO:0003823	antigen binding	IBA	molecular_function
GO:0004540	ribonuclease activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005886	plasma membrane	IBA	cellular_component
GO:0006955	immune response	IEA	biological_process
GO:0007155	cell adhesion	ISS	biological_process
GO:0007155	cell adhesion	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	NAS	biological_process
GO:0008320	protein transmembrane tra nsporter activity	NAS	molecular_function
GO:0019882	antigen processing and pr esentation	IBA	biological_process
GO:0042605	peptide antigen binding	IEA	molecular_function
GO:0042612	MHC class I protein compl ex	IEA	cellular_component
GO:0055085	transmembrane transport	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071806	protein transmembrane tra nsport	IEA	biological_process
GO:0090501	RNA phosphodiester bond h ydrolysis	IEA	biological_process
GO:0001580	detection of chemical sti mulus involved in sensory perception of bitter tas te	IDA	biological_process
GO:0001895	retina homeostasis	IEP	biological_process
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0003823	antigen binding	IBA	molecular_function
GO:0004540	ribonuclease activity	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005886	plasma membrane	IBA	cellular_component
GO:0007155	cell adhesion	ISS	biological_process
GO:0007155	cell adhesion	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	NAS	biological_process
GO:0008320	protein transmembrane tra nsporter activity	NAS	molecular_function
GO:0019882	antigen processing and pr esentation	IBA	biological_process
GO:0055085	transmembrane transport	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	PMID: 24648304
Female infertility	PMID: 24280142
Follicular development	PMID: 25595538
Oligoasthenozoospermia	PMID: 8867597
Oligozoospermia	PMID: 22182811
Endometriosis	INFBASE24648304

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24648304	Endometrio sis			10 (5 women wit h endometriosis , 5 without end ometriosis); An other cohort (1 20 endometriosi s, 20 healthy c ontrols)			Show abstract
27137486	Endometrio sis			23 (20 endometr iosis patients, 3 healthy cont rols)		AZGP1 C3	Show abstract