Endometriosis Knowledgebase

Search Result

Gene id

53832

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL20RA Gene UCSC Ensembl

Aliases

CRF2-8, IL-20R-alpha, IL-20R1, IL-20RA

Gene name

interleukin 20 receptor subunit alpha

Alternate names

interleukin-20 receptor subunit alpha, class II cytokine receptor ZCYTOR7, cytokine receptor family 2 member 8, interleukin 20 receptor alpha subunit, interleukin 20 receptor, alpha, interleukin-20 receptor I,

Gene location

6q23.3 (137045179: 136999970) Exons: 8 NC_000006.12

Gene summary(Entrez)

This gene encodes a member of the type II cytokine receptor family. The encoded protein is a subunit of the receptor for interleukin 20, a cytokine that may be involved in epidermal function. The interleukin 20 receptor is a heterodimeric complex consisting of the encoded protein and interleukin 20 receptor beta. This gene and interleukin 20 receptor beta are highly expressed in skin, and are upregulated in psoriasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

OMIM

605620

Protein Summary

Protein general information

Q9UHF4

Name: Interleukin-20 receptor subunit alpha (IL-20 receptor subunit alpha) (IL-20R-alpha) (IL-20RA) (Cytokine receptor class-II member 8) (Cytokine receptor family 2 member 8) (CRF2-8) (IL-20R1) (ZcytoR7)

Length: 553 Mass: 62,485

Tissue specificity: Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin. {ECO

Sequence

MRAPGRPALRPLPLPPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFI
YGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKS
ISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGP
PRRAQPSEKQCARTLKDQSSEFKAKIIFWYVLPVSITVFLFSVMGYSIYRYIHVGKEKHPANLILIYGNEFDKRF
FVPAEKIVINFITLNISDDSKISHQDMSLLGKSSDVSSLNDPQPSGNLRPPQEEEEVKHLGYASHLMEIFCDSEE
NTEGTSLTQQESLSRTIPPDKTVIEYEYDVRTTDICAGPEEQELSLQEEVSTQGTLLESQAALAVLGPQTLQYSY
TPQLQDLDPLAQEHTDSEEGPEEEPSTTLVDWDPQTGRLCIPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEP
APDRPPGENETYLMQFMEEWGLYVQMEN

Structural information

Protein Domains	Fibronectin (37-135) Fibronectin (136-242)
Interpro:	IPR003961 IPR036116 IPR013783 IPR015713 IPR015373
Prosite:	PS50853
Pfam:	PF09294 PF01108
CDD:	cd00063
PDB:	4DOH
PDBsum:	4DOH
STRING:	ENSP00000314976;

Other Databases

GeneCards: IL20RA; Malacards: IL20RA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004896	cytokine receptor activit y	IBA	molecular_function
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0042015	interleukin-20 binding	IBA	molecular_function
GO:0045124	regulation of bone resorp tion	IEA	biological_process
GO:2001244	positive regulation of in trinsic apoptotic signali ng pathway	IEA	biological_process
GO:0004896	cytokine receptor activit y	IBA	molecular_function
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0042015	interleukin-20 binding	IEA	molecular_function
GO:0042015	interleukin-20 binding	IBA	molecular_function
GO:0045124	regulation of bone resorp tion	IEA	biological_process
GO:2001244	positive regulation of in trinsic apoptotic signali ng pathway	IEA	biological_process
GO:0004896	cytokine receptor activit y	IBA	molecular_function
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0042015	interleukin-20 binding	IBA	molecular_function

KEGG pathways

hsa04630 Jak-STAT signaling pathway
hsa04060 Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Endometriosis	INFBASE27624484

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27624484	Endometrio sis						Show abstract