Endometriosis Knowledgebase

Search Result

Gene id

4486

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MST1R Gene UCSC Ensembl

Aliases

CD136, CDw136, NPCA3, PTK8, RON

Gene name

macrophage stimulating 1 receptor

Alternate names

macrophage-stimulating protein receptor, MSP receptor, PTK8 protein tyrosine kinase 8, c-met-related tyrosine kinase, p185-Ron,

Gene location

3p21.31 (49903636: 49886470) Exons: 21 NC_000003.12

Gene summary(Entrez)

This gene encodes a cell surface receptor for macrophage-stimulating protein (MSP) with tyrosine kinase activity. The mature form of this protein is a heterodimer of disulfide-linked alpha and beta subunits, generated by proteolytic cleavage of a single-chain precursor. The beta subunit undergoes tyrosine phosphorylation upon stimulation by MSP. This protein is expressed on the ciliated epithelia of the mucociliary transport apparatus of the lung, and together with MSP, thought to be involved in host defense. Alternative splicing generates multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Jan 2016]

OMIM

600168

Protein Summary

Protein general information

Q04912

Name: Macrophage stimulating protein receptor (MSP receptor) (EC 2.7.10.1) (CDw136) (Protein tyrosine kinase 8) (p185 Ron) (CD antigen CD136) [Cleaved into: Macrophage stimulating protein receptor alpha chain; Macrophage stimulating protein receptor beta chain]

Length: 1400 Mass: 152,271

Tissue specificity: Expressed in colon, skin, lung and bone marrow. {ECO

Sequence

MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIR
NRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQGRCFLHDLEP
QGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADA
SGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC
RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLD
TLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSFSRVDLFNGLLGPVQVTA
LYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGP
GCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVTNMPPGKHFRVDGTSV
LRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVNGTECLLARVSEGQLLCATPPGATVASVPLS
LQVGGAQVPGSWTFQYREDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCR
LPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTV
GGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLGILLPLLLLVAALATA
LVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSGLALPAIDGLDSTTCVHGASFSDSEDESCVP
LLRKESIQLRDLDSALLAEVKDVLIPHERVVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQV
EAFLREGLLMRGLNHPNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARSMEYLA
EQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQTYRFTTKSDVWSFGV
LLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVMQQCWEADPAVRPTFRVLVGEVEQIVSALLG
DHYVQLPATYMNLGPSTSHEMNVRPEQPQFSPMPGNVRRPRPLSEPPRPT

Structural information

Protein Domains	Sema. (31-522) IPT/TIG (569-671) IPT/TIG (684-767) IPT/TIG (770-860) Protein (1082-1345)
Interpro:	IPR013783 IPR014756 IPR002909 IPR011009 IPR000719 IPR017441 IPR016201 IPR001627 IPR001245 IPR008266 IPR020635 IPR016244 IPR015943
Prosite:	PS00107 PS50011 PS00109 PS51004
Pfam:	PF07714 PF01403 PF01833
PDB:	3PLS 4FWW 4QT8
PDBsum:	3PLS 4FWW 4QT8
DIP:	6029
MINT:	6539690
STRING:	ENSP00000296474;

Other Databases

GeneCards: MST1R; Malacards: MST1R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001725	stress fiber	IEA	cellular_component
GO:0005011	macrophage colony-stimula ting factor receptor acti vity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005773	vacuole	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006952	defense response	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007338	single fertilization	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0009615	response to virus	IDA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0038145	macrophage colony-stimula ting factor signaling pat hway	IEA	biological_process
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0048012	hepatocyte growth factor receptor signaling pathwa y	TAS	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001725	stress fiber	IEA	cellular_component
GO:0002376	immune system process	IEA	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0005011	macrophage colony-stimula ting factor receptor acti vity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005773	vacuole	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006952	defense response	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IEA	biological_process
GO:0007338	single fertilization	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0009615	response to virus	IEA	biological_process
GO:0009615	response to virus	IDA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0038145	macrophage colony-stimula ting factor signaling pat hway	IEA	biological_process
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0048012	hepatocyte growth factor receptor signaling pathwa y	TAS	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0005011	macrophage colony-stimula ting factor receptor acti vity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006952	defense response	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007338	single fertilization	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0009615	response to virus	IDA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0019899	enzyme binding	IPI	molecular_function
GO:0043406	positive regulation of MA P kinase activity	IDA	biological_process
GO:0048012	hepatocyte growth factor receptor signaling pathwa y	TAS	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 16210010
Nasopharyngeal cancer	OMIM: 600168
Endometriosis	INFBASE16210010
Schizophrenia	PMID: 19367581

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16210010	Endometrio sis					RON SOS 14-3-3 protein eta KSR PI3K p85and uPAR	Show abstract