Endometriosis Knowledgebase

Search Result

Gene id

4057

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

LTF Gene UCSC Ensembl

Aliases

GIG12, HEL110, HLF2, LF

Gene name

lactotransferrin

Alternate names

lactotransferrin, epididymis luminal protein 110, growth-inhibiting protein 12, kaliocin-1, lactoferricin, lactoferroxin, neutrophil lactoferrin, talalactoferrin,

Gene location

3p21.31 (46485233: 46436004) Exons: 22 NC_000003.12

Gene summary(Entrez)

This gene is a member of the transferrin family of genes and its protein product is found in the secondary granules of neutrophils. The protein is a major iron-binding protein in milk and body secretions with an antimicrobial activity, making it an important component of the non-specific immune system. The protein demonstrates a broad spectrum of properties, including regulation of iron homeostasis, host defense against a broad range of microbial infections, anti-inflammatory activity, regulation of cellular growth and differentiation and protection against cancer development and metastasis. Antimicrobial, antiviral, antifungal and antiparasitic activity has been found for this protein and its peptides. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]

OMIM

150210

Protein Summary

Protein general information

P02788

Name: Lactotransferrin (Lactoferrin) (EC 3.4.21. ) (Growth inhibiting protein 12) (Talalactoferrin) [Cleaved into: Lactoferricin H (Lfcin H); Kaliocin 1; Lactoferroxin A; Lactoferroxin B; Lactoferroxin C]

Length: 710 Mass: 78,182

Tissue specificity: High levels are found in saliva and tears, intermediate levels in serum and plasma, and low levels in urine. In kidney, detected in the distal collecting tubules in the medulla but not in the cortical region or in blood vessels. Detect

Sequence

MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADA
VTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGT
LRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDV
AFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKD
KSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELR
KCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRP
VEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCAL
CIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRK
PVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK
TTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK

Structural information

Protein Domains	Transferrin-like (25-352) Transferrin-like (364-695)
Interpro:	IPR030684 IPR016357 IPR001156 IPR018195
Prosite:	PS00205 PS00206 PS00207 PS51408
Pfam:	PF00405
PDB:	1B0L 1BKA 1CB6 1DSN 1EH3 1FCK 1H43 1H44 1H45 1HSE 1L5T 1LCF 1LCT 1LFG 1LFH 1LFI 1LGB 1N76 1SQY 1U62 1VFD 1VFE 1XV4 1XV7 1Z6V 1Z6W 2BJJ 2DP4 2GMC 2GMD 2HD4 2PMS
PDBsum:	1B0L 1BKA 1CB6 1DSN 1EH3 1FCK 1H43 1H44 1H45 1HSE 1L5T 1LCF 1LCT 1LFG 1LFH 1LFI 1LGB 1N76 1SQY 1U62 1VFD 1VFE 1XV4 1XV7 1Z6V 1Z6W 2BJJ 2DP4 2GMC 2GMD 2HD4 2PMS
DIP:	41354
MINT:	1511753
STRING:	ENSP00000231751;

Other Databases

GeneCards: LTF; Malacards: LTF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001503	ossification	IEA	biological_process
GO:0001817	regulation of cytokine pr oduction	IDA	biological_process
GO:0001895	retina homeostasis	IEP	biological_process
GO:0002227	innate immune response in mucosa	IDA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0004252	serine-type endopeptidase activity	IEA	molecular_function
GO:0005506	iron ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IMP	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006811	ion transport	IEA	biological_process
GO:0006959	humoral immune response	TAS	biological_process
GO:0008201	heparin binding	IDA	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019732	antifungal humoral respon se	IDA	biological_process
GO:0030141	secretory granule	IDA	cellular_component
GO:0031665	negative regulation of li popolysaccharide-mediated signaling pathway	IDA	biological_process
GO:0032680	regulation of tumor necro sis factor production	IDA	biological_process
GO:0032780	negative regulation of AT Pase activity	IMP	biological_process
GO:0033214	iron assimilation by chel ation and transport	TAS	biological_process
GO:0033690	positive regulation of os teoblast proliferation	IDA	biological_process
GO:0034145	positive regulation of to ll-like receptor 4 signal ing pathway	IMP	biological_process
GO:0042581	specific granule	IDA	cellular_component
GO:0043066	negative regulation of ap optotic process	ISS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular_function
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0044793	negative regulation by ho st of viral process	IMP	biological_process
GO:0045071	negative regulation of vi ral genome replication	IMP	biological_process
GO:0045454	cell redox homeostasis	TAS	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0048525	negative regulation of vi ral process	IMP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0060349	bone morphogenesis	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071902	positive regulation of pr otein serine/threonine ki nase activity	IDA	biological_process
GO:0097013	phagocytic vesicle lumen	TAS	cellular_component
GO:0097013	phagocytic vesicle lumen	TAS	cellular_component
GO:1900159	positive regulation of bo ne mineralization involve d in bone maturation	ISS	biological_process
GO:1900229	negative regulation of si ngle-species biofilm form ation in or on host organ ism	IDA	biological_process
GO:1902732	positive regulation of ch ondrocyte proliferation	IDA	biological_process
GO:2000308	negative regulation of tu mor necrosis factor (liga nd) superfamily member 11 production	ISS	biological_process
GO:2001205	negative regulation of os teoclast development	ISS	biological_process
GO:0001503	ossification	IEA	biological_process
GO:0001817	regulation of cytokine pr oduction	IEA	biological_process
GO:0001817	regulation of cytokine pr oduction	IDA	biological_process
GO:0001895	retina homeostasis	IEP	biological_process
GO:0002227	innate immune response in mucosa	IDA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0004252	serine-type endopeptidase activity	IEA	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005506	iron ion binding	IEA	molecular_function
GO:0005506	iron ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IMP	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006810	transport	IEA	biological_process
GO:0006811	ion transport	IEA	biological_process
GO:0006959	humoral immune response	TAS	biological_process
GO:0008201	heparin binding	IEA	molecular_function
GO:0008201	heparin binding	IDA	molecular_function
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008236	serine-type peptidase act ivity	IEA	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0019731	antibacterial humoral res ponse	IEA	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019732	antifungal humoral respon se	IEA	biological_process
GO:0019732	antifungal humoral respon se	IDA	biological_process
GO:0030141	secretory granule	IDA	cellular_component
GO:0031665	negative regulation of li popolysaccharide-mediated signaling pathway	IDA	biological_process
GO:0032680	regulation of tumor necro sis factor production	IDA	biological_process
GO:0032780	negative regulation of AT Pase activity	IMP	biological_process
GO:0033214	iron assimilation by chel ation and transport	TAS	biological_process
GO:0033690	positive regulation of os teoblast proliferation	IDA	biological_process
GO:0034145	positive regulation of to ll-like receptor 4 signal ing pathway	IMP	biological_process
GO:0042581	specific granule	IDA	cellular_component
GO:0042742	defense response to bacte rium	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	ISS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular_function
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0044793	negative regulation by ho st of viral process	IMP	biological_process
GO:0045071	negative regulation of vi ral genome replication	IMP	biological_process
GO:0045454	cell redox homeostasis	TAS	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048525	negative regulation of vi ral process	IMP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0055072	iron ion homeostasis	IEA	biological_process
GO:0060349	bone morphogenesis	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071902	positive regulation of pr otein serine/threonine ki nase activity	IDA	biological_process
GO:0097013	phagocytic vesicle lumen	TAS	cellular_component
GO:0097013	phagocytic vesicle lumen	TAS	cellular_component
GO:1900159	positive regulation of bo ne mineralization involve d in bone maturation	ISS	biological_process
GO:1900229	negative regulation of si ngle-species biofilm form ation in or on host organ ism	IDA	biological_process
GO:1902732	positive regulation of ch ondrocyte proliferation	IDA	biological_process
GO:2000308	negative regulation of tu mor necrosis factor (liga nd) superfamily member 11 production	ISS	biological_process
GO:2001205	negative regulation of os teoclast development	ISS	biological_process
GO:0001817	regulation of cytokine pr oduction	IDA	biological_process
GO:0001895	retina homeostasis	IEP	biological_process
GO:0002227	innate immune response in mucosa	IDA	biological_process
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005506	iron ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IMP	cellular_component
GO:0006959	humoral immune response	TAS	biological_process
GO:0008201	heparin binding	IDA	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019732	antifungal humoral respon se	IDA	biological_process
GO:0030141	secretory granule	IDA	cellular_component
GO:0031665	negative regulation of li popolysaccharide-mediated signaling pathway	IDA	biological_process
GO:0032680	regulation of tumor necro sis factor production	IDA	biological_process
GO:0032780	negative regulation of AT Pase activity	IMP	biological_process
GO:0033214	iron assimilation by chel ation and transport	TAS	biological_process
GO:0033690	positive regulation of os teoblast proliferation	IDA	biological_process
GO:0034145	positive regulation of to ll-like receptor 4 signal ing pathway	IMP	biological_process
GO:0042581	specific granule	IDA	cellular_component
GO:0043066	negative regulation of ap optotic process	ISS	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IDA	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular_function
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0044793	negative regulation by ho st of viral process	IMP	biological_process
GO:0045071	negative regulation of vi ral genome replication	IMP	biological_process
GO:0045454	cell redox homeostasis	TAS	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0048525	negative regulation of vi ral process	IMP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0060349	bone morphogenesis	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071902	positive regulation of pr otein serine/threonine ki nase activity	IDA	biological_process
GO:0097013	phagocytic vesicle lumen	TAS	cellular_component
GO:0097013	phagocytic vesicle lumen	TAS	cellular_component
GO:1900159	positive regulation of bo ne mineralization involve d in bone maturation	ISS	biological_process
GO:1900229	negative regulation of si ngle-species biofilm form ation in or on host organ ism	IDA	biological_process
GO:1902732	positive regulation of ch ondrocyte proliferation	IDA	biological_process
GO:2000308	negative regulation of tu mor necrosis factor (liga nd) superfamily member 11 production	ISS	biological_process
GO:2001205	negative regulation of os teoclast development	ISS	biological_process

Diseases

Associated diseases	References
Aggressive periodontitis	PMID: 18973542
Azoospermia	PMID: 22182811
Endometriosis	PMID: 16644090
Endometriosis	PMID: 17611835
Fertilization rate	PMID: 17094987
Idiopathic asthenozoospermia	PMID: 23455884
Nephropathy	PMID: 11748357
Oligozoospermia	PMID: 22182811
Endometriosis	INFBASE17611835

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17611835	Endometrio sis			32 (18 patients with endometri osis, 14 contro ls without endo metriosis)		Lactoferrin myeloperoxidase cancer antigen 125	Show abstract
16644090	Endometrio sis			78 (49 women wi th endometriosi s, 29 patients with functional follicle ovari an cysts)		lactoferrin	Show abstract