Endometriosis Knowledgebase

Search Result

Gene id

3984

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

LIMK1 Gene UCSC Ensembl

Aliases

LIMK, LIMK-1

Gene name

LIM domain kinase 1

Alternate names

LIM domain kinase 1, LIM motif-containing protein kinase,

Gene location

7q11.23 (74083776: 74122524) Exons: 17 NC_000007.14

Gene summary(Entrez)

There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is a serine/threonine kinase that regulates actin polymerization via phosphorylation and inactivation of the actin binding factor cofilin. This protein is ubiquitously expressed during development and plays a role in many cellular processes associated with cytoskeletal structure. This protein also stimulates axon growth and may play a role in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Feb 2011]

OMIM

601329

Protein Summary

Protein general information

P53667

Name: LIM domain kinase 1 (LIMK 1) (EC 2.7.11.1)

Length: 647 Mass: 72,585

Tissue specificity: Highest expression in both adult and fetal nervous system. Detected ubiquitously throughout the different regions of adult brain, with highest levels in the cerebral cortex. Expressed to a lesser extent in heart and skeletal muscle.

Sequence

MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKD
YWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQI
LPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILE
INGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSID
RSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDE
ETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAY
LHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRS
YDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD

Structural information

Protein Domains	LIM (25-75) LIM (84-137) PDZ. (165-258) Protein (339-604)
Interpro:	IPR011009 IPR001478 IPR000719 IPR017441 IPR001245 IPR001781
Prosite:	PS00478 PS50023 PS50106 PS00107 PS50011
Pfam:	PF00412 PF00595 PF07714
PDB:	3S95 5HVJ 5HVK 5L6W
PDBsum:	3S95 5HVJ 5HVK 5L6W
DIP:	31605
MINT:	2833166
STRING:	ENSP00000336740;

Other Databases

GeneCards: LIMK1; Malacards: LIMK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004672	protein kinase activity	NAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IMP	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007266	Rho protein signal transd uction	TAS	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0030036	actin cytoskeleton organi zation	TAS	biological_process
GO:0031072	heat shock protein bindin g	IDA	molecular_function
GO:0032233	positive regulation of ac tin filament bundle assem bly	IDA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0043005	neuron projection	ISS	cellular_component
GO:0044295	axonal growth cone	IEA	cellular_component
GO:0045773	positive regulation of ax on extension	ISS	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0051444	negative regulation of ub iquitin-protein transfera se activity	IDA	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IEA	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	NAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IMP	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007266	Rho protein signal transd uction	TAS	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0030036	actin cytoskeleton organi zation	TAS	biological_process
GO:0031072	heat shock protein bindin g	IDA	molecular_function
GO:0032233	positive regulation of ac tin filament bundle assem bly	IDA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043005	neuron projection	ISS	cellular_component
GO:0044295	axonal growth cone	IEA	cellular_component
GO:0045773	positive regulation of ax on extension	IEA	biological_process
GO:0045773	positive regulation of ax on extension	ISS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0051444	negative regulation of ub iquitin-protein transfera se activity	IDA	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IEA	biological_process
GO:0004672	protein kinase activity	NAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	IMP	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007266	Rho protein signal transd uction	TAS	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0030036	actin cytoskeleton organi zation	TAS	biological_process
GO:0031072	heat shock protein bindin g	IDA	molecular_function
GO:0032233	positive regulation of ac tin filament bundle assem bly	IDA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0043005	neuron projection	ISS	cellular_component
GO:0045773	positive regulation of ax on extension	ISS	biological_process
GO:0051444	negative regulation of ub iquitin-protein transfera se activity	IDA	biological_process

KEGG pathways

hsa04810  Regulation of actin cytoskeleton
hsa04360  Axon guidance
hsa04666  Fc gamma R-mediated phagocytosis

Diseases

Associated diseases	References
Brain hemorrhage	PMID: 16611674
Endometriosis	PMID: 25529997
Metabolic syndrome	PMID: 19056482
Endometriosis	INFBASE25529997
Williams-Beuren syndrome	KEGG: H01439

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25529997	Endometrio sis			60 (30 patients with endometri osis, 30 patien ts without endo metriosis)			Show abstract