Endometriosis Knowledgebase

Search Result

Gene id

3845

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

KRAS Gene UCSC Ensembl

Aliases

C-K-RAS, CFC2, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, KI-RAS, KRAS1, KRAS2, NS, NS3, RALD, RASK2, c-Ki-ras2

Gene name

KRAS proto-oncogene, GTPase

Alternate names

GTPase KRas, K-Ras 2, K-ras p21 protein, Kirsten rat sarcoma viral oncogene homolog, PR310 c-K-ras oncogene, c-Ki-ras, c-Kirsten-ras protein, cellular c-Ki-ras2 proto-oncogene, cellular transforming proto-oncogene, oncogene KRAS2, transforming protein p21, v-Ki-ras2,

Gene location

12p12.1 (25252092: 25204788) Exons: 8 NC_000012.12

Gene summary(Entrez)

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. [provided by RefSeq, Jul 2008]

OMIM

190070

SNPs

rs10842514

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000674.2   g.25239348C>T
NC_000012.11   g.25392282C>T
NC_000012.12   g.25239348C>T
NG_007524.1   g.16573G>A
NM_004985.4   c.111+5926G>A
NM_033360.3   c.111+5926G>A
XR_001748698.1   n.1466-4122G>A
rs11047901

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000674.2   g.25223395A>G
NC_000012.11   g.25376329A>G
NC_000012.12   g.25223395A>G
NG_007524.1   g.32526T>C
NM_004985.4   c.450+2219T>C
NM_033360.3   c.450+2219T>C
rs11047912

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000674.2   g.25232976T>C
NC_000012.11   g.25385910T>C
NC_000012.12   g.25232976T>C
NG_007524.1   g.22945A>G
NM_004985.4   c.112-5564A>G
NM_033360.3   c.112-5564A>G
XR_001748698.1   n.3716A>G
rs11047919

Strand:    Allele origin:   Allele change: A/C   Mutation type: snp

CM000674.2   g.25246187A>C
NC_000012.11   g.25399121A>C
NC_000012.12   g.25246187A>C
NG_007524.1   g.9734T>G
NM_004985.4   c.-11-792T>G
NM_033360.3   c.-11-792T>G
XR_001748698.1   n.1344-792T>G
rs1137282

Strand:    Allele origin:   Allele change: A/C/T   Mutation type: snp

CM000674.2   g.25209843A>G
NC_000012.11   g.25362777A>G
NC_000012.12   g.25209843A>G
NG_007524.1   g.46078T>C
NM_004985.4   c.519T>C
NM_033360.3   c.*73T>C
NP_004976.2   p.Asp173=
XP_011518955.1   p.Asp173=
XP_016874782.1   p.Asp212=
Clinical Significance: Likely benign

rs12313763

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000674.2   g.25209920C>T
NC_000012.11   g.25362854C>T
NC_000012.12   g.25209920C>T
NG_007524.1   g.46001G>A
NM_004985.4   c.451-9G>A
NM_033360.3   c.*5-9G>A
Clinical Significance: Likely benign

rs12579073

Strand:    Allele origin:   Allele change: A/C/T   Mutation type: snp

CM000674.2   g.25222865C>A
CM000674.2   g.25222865C>T
NC_000012.11   g.25375799C>A
NC_000012.12   g.25222865C>A
NC_000012.12   g.25222865C>T
NG_007524.1   g.33056G>A
NG_007524.1   g.33056G>T
NM_004985.4   c.450+2749G>A
NM_004985.4   c.450+2749G>T
NM_033360.3   c.450+2749G>A
NM_033360.3   c.450+2749G>T
rs17329025

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000674.2   g.25230879A>G
NC_000012.11   g.25383813A>G
NC_000012.12   g.25230879A>G
NG_007524.1   g.25042T>C
NM_004985.4   c.112-3467T>C
NM_033360.3   c.112-3467T>C
rs17388148

Strand:    Allele origin:   Allele change: G/T   Mutation type: snp

CM000674.2   g.25229252T>G
NC_000012.11   g.25382186T>G
NC_000012.12   g.25229252T>G
NG_007524.1   g.26669A>C
NM_004985.4   c.112-1840A>C
NM_033360.3   c.112-1840A>C
rs17388587

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000674.2   g.25236286A>G
NC_000012.11   g.25389220A>G
NC_000012.12   g.25236286A>G
NG_007524.1   g.19635T>C
NM_004985.4   c.112-8874T>C
NM_033360.3   c.112-8874T>C
XR_001748698.1   n.1466-1060T>C
rs17388893

Strand:    Allele origin:   Allele change: A/C   Mutation type: snp

CM000674.2   g.25240931A>C
NC_000012.11   g.25393865A>C
NC_000012.12   g.25240931A>C
NG_007524.1   g.14990T>G
NM_004985.4   c.111+4343T>G
NM_033360.3   c.111+4343T>G
XR_001748698.1   n.1465+4343T>G
rs4495968

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000674.2   g.25236573A>G
NC_000012.11   g.25389507A>C
NC_000012.11   g.25389507A>G
NC_000012.12   g.25236573A>G
NG_007524.1   g.19348T>C
NG_007524.1   g.19348T>G
NM_004985.4   c.111+8701T>C
NM_004985.4   c.111+8701T>G
NM_033360.3   c.111+8701T>C
NM_033360.3   c.111+8701T>G
XR_001748698.1   n.1466-1347T>C
rs6487464

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000674.2   g.25238522C>T
NC_000012.11   g.25391456C>T
NC_000012.12   g.25238522C>T
NG_007524.1   g.17399G>A
NM_004985.4   c.111+6752G>A
NM_033360.3   c.111+6752G>A
XR_001748698.1   n.1466-3296G>A
rs7309670

Strand:    Allele origin:   Allele change: A/C/G   Mutation type: snp

CM000674.2   g.25246039G>A
CM000674.2   g.25246039G>C
NC_000012.11   g.25398973G>A
NC_000012.12   g.25246039G>A
NC_000012.12   g.25246039G>C
NG_007524.1   g.9882C>G
NG_007524.1   g.9882C>T
NM_004985.4   c.-11-644C>G
NM_004985.4   c.-11-644C>T
NM_033360.3   c.-11-644C>G
NM_033360.3   c.-11-644C>T
XR_001748698.1   n.1344-644C>G
XR_001748698.1   n.1344-644C>T
rs9266

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000674.2   g.25209283A>G
NC_000012.11   g.25362217A>G
NC_000012.12   g.25209283A>G
NG_007524.1   g.46638T>C
NM_004985.4   c.*512T>C
NM_033360.3   c.*633T>C
Clinical Significance: Likely benign

Protein Summary

Protein general information

P01116

Name: GTPase KRas (K Ras 2) (Ki Ras) (c K ras) (c Ki ras) [Cleaved into: GTPase KRas, N terminally processed]

Length: 189 Mass: 21,656

Sequence

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTG
EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQ
RVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM

Structural information

Motifs	Effector region.(32-40)
Interpro:	IPR027417 IPR005225 IPR001806 IPR020849
Prosite:	PS51421
Pfam:	PF00071
PDB:	1D8D 1D8E 1KZO 1KZP 3GFT 4DSN 4DSO 4EPR 4EPT 4EPV 4EPW 4EPX 4EPY 4L8G 4LDJ 4LPK 4LRW 4LUC 4LV6 4LYF 4LYH 4LYJ 4M1O 4M1S 4M1T 4M1W 4M1Y 4M21 4M22 4NMM 4OBE 4PZY 4PZZ 4Q01 4Q02 4Q03 4QL3 4TQ9 4TQA 4WA7 5F2E 5TAR 5TB5 5UQW 5US4 5USJ
PDBsum:	1D8D 1D8E 1KZO 1KZP 3GFT 4DSN 4DSO 4EPR 4EPT 4EPV 4EPW 4EPX 4EPY 4L8G 4LDJ 4LPK 4LRW 4LUC 4LV6 4LYF 4LYH 4LYJ 4M1O 4M1S 4M1T 4M1W 4M1Y 4M21 4M22 4NMM 4OBE 4PZY 4PZZ 4Q01 4Q02 4Q03 4QL3 4TQ9 4TQA 4WA7 5F2E 5TAR 5TB5 5UQW 5US4 5USJ
DIP:	33951
MINT:	131580
STRING:	ENSP00000256078;

Other Databases

GeneCards: KRAS; Malacards: KRAS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0003924	GTPase activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological_process
GO:0007265	Ras protein signal transd uction	TAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008542	visual learning	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0019002	GMP binding	IEA	molecular_function
GO:0019003	GDP binding	IEA	molecular_function
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0021897	forebrain astrocyte devel opment	IEA	biological_process
GO:0030036	actin cytoskeleton organi zation	IEA	biological_process
GO:0030275	LRR domain binding	IEA	molecular_function
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IDA	cellular_component
GO:0031647	regulation of protein sta bility	IMP	biological_process
GO:0032228	regulation of synaptic tr ansmission, GABAergic	IEA	biological_process
GO:0032403	protein complex binding	IDA	molecular_function
GO:0035022	positive regulation of Ra c protein signal transduc tion	IEA	biological_process
GO:0035176	social behavior	IEA	biological_process
GO:0038002	endocrine signaling	IEA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0043406	positive regulation of MA P kinase activity	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045596	negative regulation of ce ll differentiation	IEA	biological_process
GO:0048169	regulation of long-term n euronal synaptic plastici ty	IEA	biological_process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IEA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051146	striated muscle cell diff erentiation	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051385	response to mineralocorti coid	IEA	biological_process
GO:0060441	epithelial tube branching involved in lung morphog enesis	IEA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0003924	GTPase activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007165	signal transduction	IEA	biological_process
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological_process
GO:0007264	small GTPase mediated sig nal transduction	IEA	biological_process
GO:0007265	Ras protein signal transd uction	IEA	biological_process
GO:0007265	Ras protein signal transd uction	TAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008542	visual learning	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0019002	GMP binding	IEA	molecular_function
GO:0019003	GDP binding	IEA	molecular_function
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0021897	forebrain astrocyte devel opment	IEA	biological_process
GO:0030036	actin cytoskeleton organi zation	IEA	biological_process
GO:0030275	LRR domain binding	IEA	molecular_function
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IDA	cellular_component
GO:0031647	regulation of protein sta bility	IMP	biological_process
GO:0032228	regulation of synaptic tr ansmission, GABAergic	IEA	biological_process
GO:0032403	protein complex binding	IDA	molecular_function
GO:0035022	positive regulation of Ra c protein signal transduc tion	IEA	biological_process
GO:0035176	social behavior	IEA	biological_process
GO:0038002	endocrine signaling	IEA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0043406	positive regulation of MA P kinase activity	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045596	negative regulation of ce ll differentiation	IEA	biological_process
GO:0048169	regulation of long-term n euronal synaptic plastici ty	IEA	biological_process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	IEA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051146	striated muscle cell diff erentiation	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051385	response to mineralocorti coid	IEA	biological_process
GO:0060441	epithelial tube branching involved in lung morphog enesis	IEA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological_process
GO:0007265	Ras protein signal transd uction	TAS	biological_process
GO:0007411	axon guidance	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0031234	extrinsic component of cy toplasmic side of plasma membrane	IDA	cellular_component
GO:0031647	regulation of protein sta bility	IMP	biological_process
GO:0032403	protein complex binding	IDA	molecular_function
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0050900	leukocyte migration	TAS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05161  Hepatitis B
hsa04062  Chemokine signaling pathway
hsa05224  Breast cancer
hsa04068  FoxO signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05203  Viral carcinogenesis
hsa04210  Apoptosis
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05215  Prostate cancer
hsa01522  Endocrine resistance
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04650  Natural killer cell mediated cytotoxicity
hsa04919  Thyroid hormone signaling pathway
hsa05160  Hepatitis C
hsa04722  Neurotrophin signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04360  Axon guidance
hsa04660  T cell receptor signaling pathway
hsa04371  Apelin signaling pathway
hsa04915  Estrogen signaling pathway
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05212  Pancreatic cancer
hsa04917  Prolactin signaling pathway
hsa05210  Colorectal cancer
hsa04012  ErbB signaling pathway
hsa04910  Insulin signaling pathway
hsa04150  mTOR signaling pathway
hsa04211  Longevity regulating pathway
hsa05230  Central carbon metabolism in cancer
hsa04071  Sphingolipid signaling pathway
hsa04140  Autophagy - animal
hsa05034  Alcoholism
hsa05219  Bladder cancer
hsa05211  Renal cell carcinoma
hsa04914  Progesterone-mediated oocyte maturation
hsa05231  Choline metabolism in cancer
hsa04213  Longevity regulating pathway
hsa05214  Glioma
hsa05213  Endometrial cancer
hsa04540  Gap junction
hsa04921  Oxytocin signaling pathway
hsa04912  GnRH signaling pathway
hsa05223  Non-small cell lung cancer
hsa05221  Acute myeloid leukemia
hsa04916  Melanogenesis
hsa04726  Serotonergic synapse
hsa04370  VEGF signaling pathway
hsa04725  Cholinergic synapse
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04137  Mitophagy - animal
hsa04730  Long-term depression
hsa05216  Thyroid cancer
hsa04320  Dorso-ventral axis formation
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04720  Long-term potentiation

Diseases

Associated diseases	References
Acute myeloid leukemia	KEGG: H00003, OMIM: 190070
Angiosarcoma	KEGG: H01666
Autoimmune leukoproliferative disorder	OMIM: 190070
Cardiofaciocutaneous syndrome	OMIM: 190070
Cervical cancer	KEGG: H00030
Cholangiocarcinoma	KEGG: H00046
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Colorectal cancer	KEGG: H00020
Congenital heart defects	PMID: 19206169
Craniosynostosis	KEGG: H00458
Endometrial cancer	PMID: 19419940
Endometrial cancer	KEGG: H00026
Endometriosis	PMID: 7959333
Gallbladder cancer	KEGG: H00047
Gastric cancer	KEGG: H00018
Heart disease	PMID: 17903304
Hepatic angiosarcoma	KEGG: H01557
Hepatocellular carcinoma	KEGG: H00048
Inflammatory bowel disease	PMID: 19543899
Kaposi's sarcoma	KEGG: H00041
Medullary thyroid cancer	KEGG: H01592
Mucinous ovarian tumor	PMID: 8261457
Multiple myeloma	KEGG: H00010
Non-small cell lung cancer	KEGG: H00014
Noonan syndrome	KEGG: H00523, OMIM: 190070, KEGG: H01738
Oral cancer	KEGG: H00016
Ovarian cancer	KEGG: H00027
Pancreatic cancer	KEGG: H00019, OMIM: 190070
Polycystic ovary syndrome (PCOS)	PMID: 19631369
Endometriosis	INFBASE16973828
Schimmelpenning-Feuerstein-Mims syndrome	OMIM: 190070
Squamous cell carcinoma	KEGG: H00040
Thyroid cancer	KEGG: H00032
Ulcerative colitis	PMID: 8160776

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16973828	Endometrio sis			1918 (959 endom etriosis cases, 959 unrelated controls)			Show abstract
24018808	Endometrio sis			67 ovarian endo metrioid adenoc arcinoma(35 ass ociated with en dometriosis, 32 without endome triosis)		Beta-catenin cyclin D1 BAF250a PTEN p53 WT1	Show abstract
25361550	Endometrio sis	KRAS LCS6	Iranian	118 (58 patient s with endometr iosis, 60 contr ols)	Female infertility		Show abstract
25537670	Endometrio sis			31 ( 16 endomet riosis, 15 con trols )		K-Ras 4A K-Ras 4B	Show abstract