Endometriosis Knowledgebase

Search Result

Gene id

3627

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CXCL10 Gene UCSC Ensembl

Aliases

C7, IFI10, INP10, IP-10, SCYB10, crg-2, gIP-10, mob-1

Gene name

C-X-C motif chemokine ligand 10

Alternate names

C-X-C motif chemokine 10, 10 kDa interferon gamma-induced protein, chemokine (C-X-C motif) ligand 10, gamma IP10, interferon-inducible cytokine IP-10, protein 10 from interferon (gamma)-induced cell line, small inducible cytokine subfamily B (Cys-X-Cys), member,

Gene location

4q21.1 (76023535: 76021115) Exons: 4 NC_000004.12

Gene summary(Entrez)

This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Sep 2014]

OMIM

147310

Protein Summary

Protein general information

P02778

Name: C X C motif chemokine 10 (10 kDa interferon gamma induced protein) (Gamma IP10) (IP 10) (Small inducible cytokine B10) [Cleaved into: CXCL10(1 73)]

Length: 98 Mass: 10,881

Sequence

MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCL
NPESKAIKNLLKAVSKERSKRSP

Structural information

Interpro:	IPR001089 IPR018048 IPR001811 IPR033899
Prosite:	PS00471
Pfam:	PF00048
CDD:	cd00273
PDB:	1LV9 1O7Y 1O7Z 1O80
PDBsum:	1LV9 1O7Y 1O7Z 1O80
DIP:	5893
MINT:	91448
STRING:	ENSP00000305651;

Other Databases

GeneCards: CXCL10; Malacards: CXCL10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006935	chemotaxis	IDA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IMP	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007517	muscle organ development	TAS	biological_process
GO:0008009	chemokine activity	IDA	molecular_function
GO:0008015	blood circulation	TAS	biological_process
GO:0008201	heparin binding	IMP	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008603	cAMP-dependent protein ki nase regulator activity	TAS	molecular_function
GO:0009409	response to cold	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0010332	response to gamma radiati on	IEA	biological_process
GO:0010818	T cell chemotaxis	IMP	biological_process
GO:0010819	regulation of T cell chem otaxis	IDA	biological_process
GO:0010996	response to auditory stim ulus	IEA	biological_process
GO:0016525	negative regulation of an giogenesis	IEA	biological_process
GO:0030816	positive regulation of cA MP metabolic process	IDA	biological_process
GO:0033280	response to vitamin D	IEA	biological_process
GO:0034605	cellular response to heat	IEA	biological_process
GO:0042118	endothelial cell activati on	IGI	biological_process
GO:0042127	regulation of cell prolif eration	IDA	biological_process
GO:0043950	positive regulation of cA MP-mediated signaling	IDA	biological_process
GO:0045662	negative regulation of my oblast differentiation	IEA	biological_process
GO:0045859	regulation of protein kin ase activity	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0048248	CXCR3 chemokine receptor binding	IDA	molecular_function
GO:0051281	positive regulation of re lease of sequestered calc ium ion into cytosol	IDA	biological_process
GO:0051607	defense response to virus	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IMP	biological_process
GO:0071222	cellular response to lipo polysaccharide	IMP	biological_process
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:1901509	regulation of endothelial tube morphogenesis	IDA	biological_process
GO:1901740	negative regulation of my oblast fusion	IEA	biological_process
GO:2000406	positive regulation of T cell migration	IDA	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IEA	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	IEA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006935	chemotaxis	IDA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IMP	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007517	muscle organ development	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	TAS	molecular_function
GO:0008009	chemokine activity	IDA	molecular_function
GO:0008015	blood circulation	TAS	biological_process
GO:0008201	heparin binding	IMP	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0008603	cAMP-dependent protein ki nase regulator activity	TAS	molecular_function
GO:0009409	response to cold	IEA	biological_process
GO:0009615	response to virus	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0010332	response to gamma radiati on	IEA	biological_process
GO:0010818	T cell chemotaxis	IMP	biological_process
GO:0010819	regulation of T cell chem otaxis	IDA	biological_process
GO:0010996	response to auditory stim ulus	IEA	biological_process
GO:0016525	negative regulation of an giogenesis	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030816	positive regulation of cA MP metabolic process	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0033280	response to vitamin D	IEA	biological_process
GO:0034605	cellular response to heat	IEA	biological_process
GO:0042118	endothelial cell activati on	IGI	biological_process
GO:0042127	regulation of cell prolif eration	IDA	biological_process
GO:0043950	positive regulation of cA MP-mediated signaling	IDA	biological_process
GO:0045662	negative regulation of my oblast differentiation	IEA	biological_process
GO:0045859	regulation of protein kin ase activity	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0048248	CXCR3 chemokine receptor binding	IDA	molecular_function
GO:0051281	positive regulation of re lease of sequestered calc ium ion into cytosol	IDA	biological_process
GO:0051607	defense response to virus	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IMP	biological_process
GO:0071222	cellular response to lipo polysaccharide	IMP	biological_process
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:1901509	regulation of endothelial tube morphogenesis	IDA	biological_process
GO:1901740	negative regulation of my oblast fusion	IEA	biological_process
GO:2000406	positive regulation of T cell migration	IDA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006935	chemotaxis	IDA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IMP	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007517	muscle organ development	TAS	biological_process
GO:0008009	chemokine activity	TAS	molecular_function
GO:0008009	chemokine activity	IDA	molecular_function
GO:0008015	blood circulation	TAS	biological_process
GO:0008201	heparin binding	IMP	molecular_function
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0008603	cAMP-dependent protein ki nase regulator activity	TAS	molecular_function
GO:0010818	T cell chemotaxis	IMP	biological_process
GO:0010819	regulation of T cell chem otaxis	IDA	biological_process
GO:0030816	positive regulation of cA MP metabolic process	IDA	biological_process
GO:0042118	endothelial cell activati on	IGI	biological_process
GO:0042127	regulation of cell prolif eration	IDA	biological_process
GO:0043950	positive regulation of cA MP-mediated signaling	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0048248	CXCR3 chemokine receptor binding	IDA	molecular_function
GO:0051281	positive regulation of re lease of sequestered calc ium ion into cytosol	IDA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IMP	biological_process
GO:0071222	cellular response to lipo polysaccharide	IMP	biological_process
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:1901509	regulation of endothelial tube morphogenesis	IDA	biological_process
GO:2000406	positive regulation of T cell migration	IDA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa05164  Influenza A
hsa04668  TNF signaling pathway
hsa04657  IL-17 signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway

Diseases

Associated diseases	References
Allergic rhinitis	KEGG: H01360
Cancer	PMID: 17957030
Endometriosis	PMID: 14506929
Multiple sclerosis	PMID: 17250724
Pelvic endometriosis	PMID: 26871558
Pelvic endometriosis	PMID: 26871558
Female infertility	INFBASE14506929
Endometriosis	INFBASE14506929

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
18281042	Endometrio sis	147 (77 with en dometriosis, 70 without endome triosis)			Show abstract
14506929	Endometrio sis	120 patients un dergoing laparo scopy for pain and/or infertil ity	Female infertility	IP-10 IP-10 receptor CXCR3	Show abstract
27128987	Endometrio sis	94 (74 endometr iosis patients (stages I-II: 4 0; stages III-I V: 34) , 20 wom en without endo metriosis)	Female infertility		Show abstract