Endometriosis Knowledgebase

Search Result

Gene id

3572

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL6ST Gene UCSC Ensembl

Aliases

CD130, CDW130, GP130, IL-6RB

Gene name

interleukin 6 signal transducer

Alternate names

interleukin-6 receptor subunit beta, CD130 antigen, IL-6 receptor subunit beta, IL-6R subunit beta, gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form, gp130, oncostatin M receptor, interleukin receptor beta chain, membrane glycoprotein 130,

Gene location

5q11.2 (55994992: 55935094) Exons: 19 NC_000005.10

Gene summary(Entrez)

The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggest that this gene plays a critical role in regulating myocyte apoptosis. Alternatively spliced transcript variants have been described. A related pseudogene has been identified on chromosome 17. [provided by RefSeq, May 2014]

OMIM

600694

Protein Summary

Protein general information

P40189

Name: Interleukin 6 receptor subunit beta (IL 6 receptor subunit beta) (IL 6R subunit beta) (IL 6R beta) (IL 6RB) (CDw130) (Interleukin 6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin M receptor subunit alpha) (CD antigen CD130)

Length: 918 Mass: 103,537

Tissue specificity: Found in all the tissues and cell lines examined (PubMed

Sequence

MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIP
KEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDGGR
ETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPP
HNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKS
HLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESV
KKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTV
RTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHN
FNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKINTEGHSSGIGGSSCMSSSRPSISSSDENESS
QNTSSTVQYSTVVHSGYRHQVPSVQVFSRSESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESS
PDISHFERSKQVSSVNEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEG
MPKSYLPQTVRQGGYMPQ

Structural information

Protein Domains	Ig-like (26-120) Fibronectin (125-216) Fibronectin (224-324) Fibronectin (329-424)
Motifs	WSXWS motif(310-314) Box 1(651-659)
Interpro:	IPR003961 IPR003529 IPR013783 IPR010457 IPR015321
Prosite:	PS50853 PS01353
Pfam:	PF00041 PF09240 PF06328
CDD:	cd00063
PDB:	1BJ8 1BQU 1I1R 1N2Q 1P9M 1PVH 3L5H 3L5I 3L5J
PDBsum:	1BJ8 1BQU 1I1R 1N2Q 1P9M 1PVH 3L5H 3L5I 3L5J
DIP:	95
MINT:	130473
STRING:	ENSP00000338799;

Other Databases

GeneCards: IL6ST; Malacards: IL6ST

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002675	positive regulation of ac ute inflammatory response	IC	biological_process
GO:0002821	positive regulation of ad aptive immune response	IC	biological_process
GO:0004897	ciliary neurotrophic fact or receptor activity	IDA	molecular_function
GO:0004921	interleukin-11 receptor a ctivity	IEA	molecular_function
GO:0005127	ciliary neurotrophic fact or receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0005900	oncostatin-M receptor com plex	IDA	cellular_component
GO:0005977	glycogen metabolic proces s	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IGI	biological_process
GO:0008593	regulation of Notch signa ling pathway	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0010575	positive regulation of va scular endothelial growth factor production	TAS	biological_process
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019970	interleukin-11 binding	IEA	molecular_function
GO:0030425	dendrite	IEA	cellular_component
GO:0034097	response to cytokine	IDA	biological_process
GO:0034097	response to cytokine	IDA	biological_process
GO:0038154	interleukin-11-mediated s ignaling pathway	IEA	biological_process
GO:0038165	oncostatin-M-mediated sig naling pathway	IMP	biological_process
GO:0042102	positive regulation of T cell proliferation	IMP	biological_process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IMP	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IMP	biological_process
GO:0042803	protein homodimerization activity	TAS	molecular_function
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0045509	interleukin-27 receptor a ctivity	IC	molecular_function
GO:0045669	positive regulation of os teoblast differentiation	IMP	biological_process
GO:0048711	positive regulation of as trocyte differentiation	IEA	biological_process
GO:0048861	leukemia inhibitory facto r signaling pathway	IDA	biological_process
GO:0048861	leukemia inhibitory facto r signaling pathway	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070102	interleukin-6-mediated si gnaling pathway	IMP	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IMP	biological_process
GO:0070104	negative regulation of in terleukin-6-mediated sign aling pathway	IDA	biological_process
GO:0070106	interleukin-27-mediated s ignaling pathway	IMP	biological_process
GO:0070110	ciliary neurotrophic fact or receptor complex	IDA	cellular_component
GO:0070120	ciliary neurotrophic fact or-mediated signaling pat hway	IDA	biological_process
GO:0004915	interleukin-6 receptor ac tivity	IDA	molecular_function
GO:0004915	interleukin-6 receptor ac tivity	IDA	molecular_function
GO:0004923	leukemia inhibitory facto r receptor activity	IDA	molecular_function
GO:0004923	leukemia inhibitory facto r receptor activity	IDA	molecular_function
GO:0004924	oncostatin-M receptor act ivity	IDA	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019981	interleukin-6 binding	IPI	molecular_function
GO:0002675	positive regulation of ac ute inflammatory response	IC	biological_process
GO:0002821	positive regulation of ad aptive immune response	IC	biological_process
GO:0004896	cytokine receptor activit y	IEA	molecular_function
GO:0004897	ciliary neurotrophic fact or receptor activity	IDA	molecular_function
GO:0004921	interleukin-11 receptor a ctivity	IEA	molecular_function
GO:0005127	ciliary neurotrophic fact or receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0005900	oncostatin-M receptor com plex	IDA	cellular_component
GO:0005977	glycogen metabolic proces s	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IGI	biological_process
GO:0008593	regulation of Notch signa ling pathway	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0010575	positive regulation of va scular endothelial growth factor production	TAS	biological_process
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	TAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019970	interleukin-11 binding	IEA	molecular_function
GO:0030425	dendrite	IEA	cellular_component
GO:0034097	response to cytokine	IDA	biological_process
GO:0034097	response to cytokine	IDA	biological_process
GO:0038154	interleukin-11-mediated s ignaling pathway	IEA	biological_process
GO:0038165	oncostatin-M-mediated sig naling pathway	IMP	biological_process
GO:0042102	positive regulation of T cell proliferation	IMP	biological_process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IMP	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IMP	biological_process
GO:0042803	protein homodimerization activity	TAS	molecular_function
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0044297	cell body	IEA	cellular_component
GO:0045509	interleukin-27 receptor a ctivity	IC	molecular_function
GO:0045669	positive regulation of os teoblast differentiation	IMP	biological_process
GO:0048711	positive regulation of as trocyte differentiation	IEA	biological_process
GO:0048861	leukemia inhibitory facto r signaling pathway	IDA	biological_process
GO:0048861	leukemia inhibitory facto r signaling pathway	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070102	interleukin-6-mediated si gnaling pathway	IMP	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IMP	biological_process
GO:0070104	negative regulation of in terleukin-6-mediated sign aling pathway	IDA	biological_process
GO:0070106	interleukin-27-mediated s ignaling pathway	IMP	biological_process
GO:0070110	ciliary neurotrophic fact or receptor complex	IDA	cellular_component
GO:0070120	ciliary neurotrophic fact or-mediated signaling pat hway	IDA	biological_process
GO:0004915	interleukin-6 receptor ac tivity	IDA	molecular_function
GO:0004915	interleukin-6 receptor ac tivity	IDA	molecular_function
GO:0004923	leukemia inhibitory facto r receptor activity	IDA	molecular_function
GO:0004923	leukemia inhibitory facto r receptor activity	IDA	molecular_function
GO:0004924	oncostatin-M receptor act ivity	IDA	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019981	interleukin-6 binding	IPI	molecular_function
GO:0002675	positive regulation of ac ute inflammatory response	IC	biological_process
GO:0002821	positive regulation of ad aptive immune response	IC	biological_process
GO:0004897	ciliary neurotrophic fact or receptor activity	IDA	molecular_function
GO:0005127	ciliary neurotrophic fact or receptor binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0005900	oncostatin-M receptor com plex	IDA	cellular_component
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IGI	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	TAS	biological_process
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019838	growth factor binding	IPI	molecular_function
GO:0034097	response to cytokine	IDA	biological_process
GO:0034097	response to cytokine	IDA	biological_process
GO:0038165	oncostatin-M-mediated sig naling pathway	IMP	biological_process
GO:0042102	positive regulation of T cell proliferation	IMP	biological_process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IMP	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IMP	biological_process
GO:0042803	protein homodimerization activity	TAS	molecular_function
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0045509	interleukin-27 receptor a ctivity	IC	molecular_function
GO:0045669	positive regulation of os teoblast differentiation	IMP	biological_process
GO:0048861	leukemia inhibitory facto r signaling pathway	IDA	biological_process
GO:0048861	leukemia inhibitory facto r signaling pathway	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070102	interleukin-6-mediated si gnaling pathway	IMP	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IMP	biological_process
GO:0070104	negative regulation of in terleukin-6-mediated sign aling pathway	IDA	biological_process
GO:0070106	interleukin-27-mediated s ignaling pathway	IMP	biological_process
GO:0070110	ciliary neurotrophic fact or receptor complex	IDA	cellular_component
GO:0070120	ciliary neurotrophic fact or-mediated signaling pat hway	IDA	biological_process
GO:0004915	interleukin-6 receptor ac tivity	IDA	molecular_function
GO:0004915	interleukin-6 receptor ac tivity	IDA	molecular_function
GO:0004923	leukemia inhibitory facto r receptor activity	IDA	molecular_function
GO:0004923	leukemia inhibitory facto r receptor activity	IDA	molecular_function
GO:0004924	oncostatin-M receptor act ivity	IDA	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019981	interleukin-6 binding	IPI	molecular_function

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04630  Jak-STAT signaling pathway
hsa05203  Viral carcinogenesis
hsa04659  Th17 cell differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells

Diseases

Associated diseases	References
Asthenozoospermia	PMID: 16728717
Celiac disease	PMID: 19240061
Coronary disease	PMID: 19336475
Endometriosis	PMID: 25631342
Obesity	PMID: 12917504
Periodontitis	PMID: 15081423
Female infertility	INFBASE25631342
Endometriosis	INFBASE18353903
Polycystic ovary syndrome (PCOS)	PMID: 20103703
Primary unexplained�infertility	PMID: 12161539

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25631342	Endometrio sis			89 (65 women in vestigated for secondary infer tility, 23 cont rols)	Female infertility	IL-1A IL-6 LIF LIFR and gp130	Show abstract
18353903	Endometrio sis			16 (10 patients with laparosco pically proven endometriosis ( minimal/mild n = 5 and moderat e/severe n = 5) , 6 controls)		PCDH17 PTPRR IL6ST	Show abstract