Endometriosis Knowledgebase

Search Result

Gene id

3397

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ID1 Gene UCSC Ensembl

Aliases

ID, bHLHb24

Gene name

inhibitor of DNA binding 1, HLH protein

Alternate names

DNA-binding protein inhibitor ID-1, class B basic helix-loop-helix protein 24, dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein), inhibitor of DNA binding 1, dominant negative helix-loop-helix protein, inhibitor of differen,

Gene location

20q11.21 (31605282: 31606514) Exons: 1 NC_000020.11

Gene summary(Entrez)

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

OMIM

600349

Protein Summary

Protein general information

P41134

Name: DNA binding protein inhibitor ID 1 (Class B basic helix loop helix protein 24) (bHLHb24) (Inhibitor of DNA binding 1) (Inhibitor of differentiation 1)

Length: 155 Mass: 16,133

Sequence

MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSR
LKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADD
RILCR

Structural information

Protein Domains	bHLH. (53-105)
Motifs	Nuclear export(98-111)
Interpro:	IPR011598 IPR026052
Prosite:	PS50888
Pfam:	PF00010
CDD:	cd00083
DIP:	38112
STRING:	ENSP00000365280;

Other Databases

GeneCards: ID1; Malacards: ID1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0001525	angiogenesis	TAS	biological_process
GO:0001886	endothelial cell morphoge nesis	IEA	biological_process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IC	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005813	centrosome	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0008022	protein C-terminus bindin g	IEA	molecular_function
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0010621	negative regulation of tr anscription by transcript ion factor localization	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0030182	neuron differentiation	IEA	biological_process
GO:0030509	BMP signaling pathway	IEA	biological_process
GO:0031648	protein destabilization	IEA	biological_process
GO:0032233	positive regulation of ac tin filament bundle assem bly	IEA	biological_process
GO:0032963	collagen metabolic proces s	IEA	biological_process
GO:0036164	cell-abiotic substrate ad hesion	IEA	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043408	regulation of MAPK cascad e	IEA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0043534	blood vessel endothelial cell migration	TAS	biological_process
GO:0043621	protein self-association	IEA	molecular_function
GO:0045602	negative regulation of en dothelial cell differenti ation	IEA	biological_process
GO:0045668	negative regulation of os teoblast differentiation	IEA	biological_process
GO:0045765	regulation of angiogenesi s	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046677	response to antibiotic	IEA	biological_process
GO:0047485	protein N-terminus bindin g	IEA	molecular_function
GO:0048514	blood vessel morphogenesi s	TAS	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050774	negative regulation of de ndrite morphogenesis	IEA	biological_process
GO:0060425	lung morphogenesis	IEA	biological_process
GO:0060426	lung vasculature developm ent	IEA	biological_process
GO:0070628	proteasome binding	IEA	molecular_function
GO:0071364	cellular response to epid ermal growth factor stimu lus	IEA	biological_process
GO:0090074	negative regulation of pr otein homodimerization ac tivity	IEA	biological_process
GO:1901653	cellular response to pept ide	IEA	biological_process
GO:1903026	negative regulation of RN A polymerase II regulator y region sequence-specifi c DNA binding	IEA	biological_process
GO:1903351	cellular response to dopa mine	IEA	biological_process
GO:1990090	cellular response to nerv e growth factor stimulus	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0001525	angiogenesis	TAS	biological_process
GO:0001886	endothelial cell morphoge nesis	IEA	biological_process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IC	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005813	centrosome	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007420	brain development	IEA	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0008022	protein C-terminus bindin g	IEA	molecular_function
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0010621	negative regulation of tr anscription by transcript ion factor localization	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0030182	neuron differentiation	IEA	biological_process
GO:0030509	BMP signaling pathway	IEA	biological_process
GO:0031648	protein destabilization	IEA	biological_process
GO:0032091	negative regulation of pr otein binding	IEA	biological_process
GO:0032233	positive regulation of ac tin filament bundle assem bly	IEA	biological_process
GO:0032963	collagen metabolic proces s	IEA	biological_process
GO:0036164	cell-abiotic substrate ad hesion	IEA	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043392	negative regulation of DN A binding	IEA	biological_process
GO:0043408	regulation of MAPK cascad e	IEA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0043534	blood vessel endothelial cell migration	TAS	biological_process
GO:0043621	protein self-association	IEA	molecular_function
GO:0045602	negative regulation of en dothelial cell differenti ation	IEA	biological_process
GO:0045668	negative regulation of os teoblast differentiation	IEA	biological_process
GO:0045765	regulation of angiogenesi s	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046677	response to antibiotic	IEA	biological_process
GO:0046983	protein dimerization acti vity	IEA	molecular_function
GO:0047485	protein N-terminus bindin g	IEA	molecular_function
GO:0048511	rhythmic process	IEA	biological_process
GO:0048514	blood vessel morphogenesi s	TAS	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050774	negative regulation of de ndrite morphogenesis	IEA	biological_process
GO:0060425	lung morphogenesis	IEA	biological_process
GO:0060426	lung vasculature developm ent	IEA	biological_process
GO:0070628	proteasome binding	IEA	molecular_function
GO:0071364	cellular response to epid ermal growth factor stimu lus	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:0090074	negative regulation of pr otein homodimerization ac tivity	IEA	biological_process
GO:1901342	regulation of vasculature development	IEA	biological_process
GO:1901653	cellular response to pept ide	IEA	biological_process
GO:1903026	negative regulation of RN A polymerase II regulator y region sequence-specifi c DNA binding	IEA	biological_process
GO:1903351	cellular response to dopa mine	IEA	biological_process
GO:1990090	cellular response to nerv e growth factor stimulus	IEA	biological_process
GO:0001525	angiogenesis	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IC	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0007179	transforming growth facto r beta receptor signaling pathway	TAS	biological_process
GO:0010621	negative regulation of tr anscription by transcript ion factor localization	TAS	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0043534	blood vessel endothelial cell migration	TAS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0048514	blood vessel morphogenesi s	TAS	biological_process

KEGG pathways

hsa04015  Rap1 signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04390  Hippo signaling pathway
hsa04350  TGF-beta signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 26577912
Endometriosis	INFBASE26577912

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26577912	Endometrio sis			29 women with e ndometriosis			Show abstract