Endometriosis Knowledgebase

Search Result

Gene id

3383

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ICAM1 Gene UCSC Ensembl

Aliases

BB2, CD54, P3.58

Gene name

intercellular adhesion molecule 1

Alternate names

intercellular adhesion molecule 1, ICAM-1, cell surface glycoprotein P3.58, intercellular adhesion molecule 1 (CD54), human rhinovirus receptor, major group rhinovirus receptor,

Gene location

19p13.2 (10270840: 10286614) Exons: 7 NC_000019.10

Gene summary(Entrez)

This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by RefSeq, Jul 2008]

OMIM

147840

SNPs

rs1799969

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000681.2   g.10284116G>A
NC_000019.10   g.10284116G>A
NC_000019.9   g.10394792G>A
NG_007728.1   g.2143G>A
NG_012083.1   g.18276G>A
NM_000201.2   c.721G>A
NP_000192.2   p.Gly241Arg
XP_005259946.1   p.Gly152Arg
XR_001753867.1   n.-642C>T
rs5498

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000681.2   g.10285007A>G
NC_000019.10   g.10285007A>G
NC_000019.9   g.10395683A>G
NG_007728.1   g.3034A>G
NG_012083.1   g.19167A>G
NM_000201.2   c.1405A>G
NM_001039132.2   c.-2006A>G
NM_001544.4   c.-2006A>G
NM_022377.3   c.-2006A>G
NP_000192.2   p.Lys469Glu
XP_005259946.1   p.Lys380Glu
XP_005259947.1   p.Lys247Glu
XR_001753867.1   n.-1533T>C

Protein Summary

Protein general information

P05362

Name: Intercellular adhesion molecule 1 (ICAM 1) (Major group rhinovirus receptor) (CD antigen CD54)

Length: 532 Mass: 57,825

Sequence

MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNN
RKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVL
LRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPR
VLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATL
EVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRD
LEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKP
NTQATPP

Structural information

Protein Domains	Ig-like (41-103) Ig-like (128-193) Ig-like (230-297) Ig-like (325-378) Ig-like (412-464)
Motifs	Cell attachment(152-154) ({ECO:0000255}.-)
Interpro:	IPR003988 IPR013768 IPR003987 IPR007110 IPR013783 IPR003599
Pfam:	PF03921
PDB:	1D3E 1D3I 1D3L 1IAM 1IC1 1IJ4 1MQ8 1P53 1Z7Z 2OZ4 3TCX 5MZA
PDBsum:	1D3E 1D3I 1D3L 1IAM 1IC1 1IJ4 1MQ8 1P53 1Z7Z 2OZ4 3TCX 5MZA
DIP:	36658
MINT:	4053071
STRING:	ENSP00000264832;

Other Databases

GeneCards: ICAM1; Malacards: ICAM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001541	ovarian follicle developm ent	IEA	biological_process
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001772	immunological synapse	IEA	cellular_component
GO:0001910	regulation of leukocyte m ediated cytotoxicity	TAS	biological_process
GO:0001975	response to amphetamine	IEA	biological_process
GO:0002291	T cell activation via T c ell receptor contact with antigen bound to MHC mol ecule on antigen presenti ng cell	IMP	biological_process
GO:0002438	acute inflammatory respon se to antigenic stimulus	IEA	biological_process
GO:0002457	T cell antigen processing and presentation	IEA	biological_process
GO:0002693	positive regulation of ce llular extravasation	IMP	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	TAS	molecular_function
GO:0005178	integrin binding	IPI	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	IDA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	TAS	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IMP	biological_process
GO:0007569	cell aging	IEA	biological_process
GO:0007605	sensory perception of sou nd	IEA	biological_process
GO:0008360	regulation of cell shape	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010212	response to ionizing radi ation	IEA	biological_process
GO:0010477	response to sulfur dioxid e	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0022614	membrane to membrane dock ing	IEP	biological_process
GO:0030155	regulation of cell adhesi on	IEA	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030838	positive regulation of ac tin filament polymerizati on	IEA	biological_process
GO:0031669	cellular response to nutr ient levels	IEA	biological_process
GO:0033627	cell adhesion mediated by integrin	IEA	biological_process
GO:0034698	response to gonadotropin	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043200	response to amino acid	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0044406	adhesion of symbiont to h ost	IDA	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045907	positive regulation of va soconstriction	IEA	biological_process
GO:0046688	response to copper ion	IEA	biological_process
GO:0046718	viral entry into host cel l	IEA	biological_process
GO:0046813	receptor-mediated virion attachment to host cell	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050900	leukocyte migration	IEP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051926	negative regulation of ca lcium ion transport	IEA	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0061028	establishment of endothel ial barrier	IGI	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071312	cellular response to alka loid	IEA	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0097368	establishment of Sertoli cell barrier	IEA	biological_process
GO:1900027	regulation of ruffle asse mbly	IEA	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IDA	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:0001541	ovarian follicle developm ent	IEA	biological_process
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001772	immunological synapse	IEA	cellular_component
GO:0001910	regulation of leukocyte m ediated cytotoxicity	TAS	biological_process
GO:0001975	response to amphetamine	IEA	biological_process
GO:0002291	T cell activation via T c ell receptor contact with antigen bound to MHC mol ecule on antigen presenti ng cell	IMP	biological_process
GO:0002438	acute inflammatory respon se to antigenic stimulus	IEA	biological_process
GO:0002457	T cell antigen processing and presentation	IEA	biological_process
GO:0002693	positive regulation of ce llular extravasation	IMP	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	TAS	molecular_function
GO:0005178	integrin binding	IEA	molecular_function
GO:0005178	integrin binding	IPI	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	NAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IDA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	TAS	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IEA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IMP	biological_process
GO:0007569	cell aging	IEA	biological_process
GO:0007605	sensory perception of sou nd	IEA	biological_process
GO:0008360	regulation of cell shape	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010212	response to ionizing radi ation	IEA	biological_process
GO:0010477	response to sulfur dioxid e	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016337	single organismal cell-ce ll adhesion	IEA	biological_process
GO:0016337	single organismal cell-ce ll adhesion	IEA	biological_process
GO:0022614	membrane to membrane dock ing	IEP	biological_process
GO:0030155	regulation of cell adhesi on	IEA	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030838	positive regulation of ac tin filament polymerizati on	IEA	biological_process
GO:0031669	cellular response to nutr ient levels	IEA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0033627	cell adhesion mediated by integrin	IEA	biological_process
GO:0034698	response to gonadotropin	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043200	response to amino acid	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0044406	adhesion of symbiont to h ost	IDA	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045907	positive regulation of va soconstriction	IEA	biological_process
GO:0046688	response to copper ion	IEA	biological_process
GO:0046718	viral entry into host cel l	IEA	biological_process
GO:0046813	receptor-mediated virion attachment to host cell	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050900	leukocyte migration	IEP	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0051926	negative regulation of ca lcium ion transport	IEA	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0061028	establishment of endothel ial barrier	IGI	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071310	cellular response to orga nic substance	IEA	biological_process
GO:0071312	cellular response to alka loid	IEA	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0097368	establishment of Sertoli cell barrier	IEA	biological_process
GO:1900027	regulation of ruffle asse mbly	IEA	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IDA	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IDA	biological_process
GO:0001910	regulation of leukocyte m ediated cytotoxicity	TAS	biological_process
GO:0002291	T cell activation via T c ell receptor contact with antigen bound to MHC mol ecule on antigen presenti ng cell	IMP	biological_process
GO:0002693	positive regulation of ce llular extravasation	IMP	biological_process
GO:0004872	receptor activity	TAS	molecular_function
GO:0004888	transmembrane signaling r eceptor activity	TAS	molecular_function
GO:0005178	integrin binding	IPI	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	NAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	IDA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	TAS	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IMP	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0022614	membrane to membrane dock ing	IEP	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0044406	adhesion of symbiont to h ost	IDA	biological_process
GO:0046813	receptor-mediated virion attachment to host cell	IDA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050900	leukocyte migration	IEP	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0061028	establishment of endothel ial barrier	IGI	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IDA	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IDA	biological_process

KEGG pathways

hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05164  Influenza A
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04668  TNF signaling pathway
hsa04514  Cell adhesion molecules
hsa04650  Natural killer cell mediated cytotoxicity
hsa05323  Rheumatoid arthritis
hsa04064  NF-kappa B signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa05144  Malaria
hsa05416  Viral myocarditis
hsa05143  African trypanosomiasis
hsa05150  Staphylococcus aureus infection

Diseases

Associated diseases	References
Allergies	PMID: 11354638
Alzheimer's disease	PMID: 15854776
Amyotrophic lateral sclerosis (ALS)	PMID: 18513389
Arthritis	PMID: 11981324
Behcet's disease	PMID: 19906207
Biliary Atresia	PMID: 18401716
Cancer	PMID: 19822019
Celiac disease	PMID: 16916657
Cerebrovascular disease	PMID: 12871600
Cholangitis	PMID: 16750586
Chronic kidney failure	PMID: 19497039
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Crohn's disease	PMID: 15958080
Defective endometrial receptivity	PMID: 25935494
Diabetes	PMID: 19587357
Diabetic retinopathy	PMID: 12027924
Endometriosis	PMID: 11716965
Endometriosis	PMID: 12551787
Erythema nodosum	PMID: 14760823
Gastroschisis	PMID: 17051589
Glomerulonephritis	PMID: 19420105
Graves disease	PMID: 14557478
Graves ophthalmopathy	PMID: 17521325
Hyperandrogenism	PMID: 27381237
Inflammatory bowel disease	PMID: 12477764
Kidney disease	PMID: 18627514
Male immune infertility	PMID: 25597177
Melanoma	PMID: 16313300
Migraine disorders	PMID: 19559392
Multiple sclerosis	PMID: 12590979
Multiple system atrophy	PMID: 15607204
Ovarian hyperstimulation syndrome(OHSS)	PMID: 16028375
Pancreatitis	PMID: 15917409
Pelvic endometriosis	PMID: 11937115
Periodontitis	PMID: 16512757
Polycystic ovary syndrome (PCOS)	PMID: 16968464
Polymyalgia rheumatica	PMID: 10813290
Premature birth	PMID: 18851856
Pelvic endometriosis	INFBASE11937115
Female infertility	INFBASE11326914
Endometriosis associated infertility	INFBASE9848307
Endometriosis	INFBASE9848307
Recurrent miscarriage	PMID: 26368793
Restenosis	PMID: 14975197
Rheumatoid arthritis	PMID: 11508575
Schizophrenia	PMID: 15756053
Vascular dementia	PMID: 12095649

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
11716965	Endometrio sis			22 (10 endometr iosis patients, 12 controls)		CD54	Show abstract
11326914	Endometrio sis			45 (15 endometr ium and 15 endo metriotic tissu es of patients with endometrio sis, 30 endomet rium from non-e ndometriosis su bjects)	Female infertility	Integrin beta 3 ICAM	Show abstract
19661147	Endometrio sis					ICAM1 MMP9 TNF MMP1	Show abstract
14688178	Endometrio sis			374 (176 subjec ts with surgica lly confirmed e ndometriosis (1 34 patients wit h stage I-II an d 42 patients w ith stage III-I V), 198 control s)			Show abstract
9848307	Endometrio sis			71 (36 patients with endometri osis served as cases, 35 pati ents without en dometriosis)	Female infertility	ICAM-1 IFN-gamma	Show abstract
15212674	Endometrio sis			8 women with mo derate to sever e stages of end ometriosis			Show abstract
20422421	Endometrio sis	ICAM-1 (codon 241 polymorphisms)	Iranian	204 (84 unrelat ed patients, 12 0 consecutive u nrelated health y controls)		ICAM-1	Show abstract
16938116	Endometrio sis	IL-6 -634C/G, ICAM-1 469K/E	Japanes e	438 (202 patien ts with endomet riosis, 236 con trol women)		IL-6 ICAM-1	Show abstract
12529420	Endometrio sis	ICAM-1 (codons 241 (G/R241), 469 (E/K469))	Italian Caucas ian	363 (188 women with endometrio sis, 175 subje cts without end ometriosis)		ICAM-1	Show abstract
11963839	Endometrio sis					VCAM-1 ICAM-1	Show abstract
22736326	Endometrio sis			353 (121 contro ls without endo metriosis at la paroscopy and f rom 232 women w ith endometrios is (minimal-mil d n = 148; mode rate-severe n = 84))		Annexin V VEGF CA-125 and sICAM-1 glycodelin	Show abstract
10224799	Endometrio sis					ICAM-1 E-Selectin	Show abstract
12551787	Endometrio sis			86 (67 patients with endometri osis, 19 contro ls)		ICAM-1	Show abstract
11937115	Endometrio sis (Pelvi c)		Japanes e	54 (28 women wi th endometriosi s, 26 women wit hout endometrio sis)		ICAM-1 KIR	Show abstract