Endometriosis Knowledgebase

Search Result

Gene id

3065

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HDAC1 Gene UCSC Ensembl

Aliases

GON-10, HD1, RPD3, RPD3L1

Gene name

histone deacetylase 1

Alternate names

histone deacetylase 1, reduced potassium dependency, yeast homolog-like 1,

Gene location

1p35.2-p35.1 (32292102: 32333627) Exons: 14 NC_000001.11

Gene summary(Entrez)

Histone acetylation and deacetylation, catalyzed by multisubunit complexes, play a key role in the regulation of eukaryotic gene expression. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family and is a component of the histone deacetylase complex. It also interacts with retinoblastoma tumor-suppressor protein and this complex is a key element in the control of cell proliferation and differentiation. Together with metastasis-associated protein-2, it deacetylates p53 and modulates its effect on cell growth and apoptosis. [provided by RefSeq, Jul 2008]

OMIM

601241

Protein Summary

Protein general information

Q13547

Name: Histone deacetylase 1 (HD1) (EC 3.5.1.98)

Length: 482 Mass: 55,103

Tissue specificity: Ubiquitous, with higher levels in heart, pancreas and testis, and lower levels in kidney and brain.

Sequence

MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKF
LRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGF
CYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVN
YPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPH
APGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKE
KDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA

Structural information

Interpro:	IPR000286 IPR003084 IPR023801
Pfam:	PF00850
PDB:	1TYI 4BKX 5ICN
PDBsum:	1TYI 4BKX 5ICN
DIP:	24184
MINT:	90475
STRING:	ENSP00000362649;

Other Databases

GeneCards: HDAC1; Malacards: HDAC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000118	histone deacetylase compl ex	TAS	cellular_component
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000785	chromatin	IDA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular_function
GO:0001047	core promoter binding	IDA	molecular_function
GO:0001085	RNA polymerase II transcr iption factor binding	IPI	molecular_function
GO:0001103	RNA polymerase II repress ing transcription factor binding	IPI	molecular_function
GO:0001106	RNA polymerase II transcr iption corepressor activi ty	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0004407	histone deacetylase activ ity	TAS	molecular_function
GO:0004407	histone deacetylase activ ity	IDA	molecular_function
GO:0004407	histone deacetylase activ ity	IMP	molecular_function
GO:0004407	histone deacetylase activ ity	IMP	molecular_function
GO:0004407	histone deacetylase activ ity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0006338	chromatin remodeling	IC	biological_process
GO:0006338	chromatin remodeling	IC	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008134	transcription factor bind ing	TAS	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009913	epidermal cell differenti ation	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0010870	positive regulation of re ceptor biosynthetic proce ss	IMP	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0016575	histone deacetylation	IMP	biological_process
GO:0016580	Sin3 complex	IDA	cellular_component
GO:0016581	NuRD complex	IDA	cellular_component
GO:0016581	NuRD complex	IDA	cellular_component
GO:0019213	deacetylase activity	ISS	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0032041	NAD-dependent histone dea cetylase activity (H3-K14 specific)	IEA	molecular_function
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0033558	protein deacetylase activ ity	IMP	molecular_function
GO:0033613	activating transcription factor binding	IPI	molecular_function
GO:0042475	odontogenesis of dentin-c ontaining tooth	ISS	biological_process
GO:0042733	embryonic digit morphogen esis	ISS	biological_process
GO:0042826	histone deacetylase bindi ng	IPI	molecular_function
GO:0043044	ATP-dependent chromatin r emodeling	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	ISS	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043922	negative regulation by ho st of viral transcription	IMP	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0047485	protein N-terminus bindin g	IDA	molecular_function
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0060766	negative regulation of an drogen receptor signaling pathway	IDA	biological_process
GO:0060789	hair follicle placode for mation	ISS	biological_process
GO:0061029	eyelid development in cam era-type eye	ISS	biological_process
GO:0061198	fungiform papilla formati on	ISS	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0070932	histone H3 deacetylation	IDA	biological_process
GO:0070933	histone H4 deacetylation	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IGI	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological_process
GO:0010832	negative regulation of my otube differentiation	IMP	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0031492	nucleosomal DNA binding	IDA	molecular_function
GO:0000118	histone deacetylase compl ex	TAS	cellular_component
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000785	chromatin	IDA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular_function
GO:0001047	core promoter binding	IDA	molecular_function
GO:0001085	RNA polymerase II transcr iption factor binding	IPI	molecular_function
GO:0001103	RNA polymerase II repress ing transcription factor binding	IPI	molecular_function
GO:0001106	RNA polymerase II transcr iption corepressor activi ty	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0004407	histone deacetylase activ ity	IEA	molecular_function
GO:0004407	histone deacetylase activ ity	IEA	molecular_function
GO:0004407	histone deacetylase activ ity	TAS	molecular_function
GO:0004407	histone deacetylase activ ity	IDA	molecular_function
GO:0004407	histone deacetylase activ ity	IMP	molecular_function
GO:0004407	histone deacetylase activ ity	IMP	molecular_function
GO:0004407	histone deacetylase activ ity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0006338	chromatin remodeling	IC	biological_process
GO:0006338	chromatin remodeling	IC	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008134	transcription factor bind ing	TAS	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009913	epidermal cell differenti ation	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0010870	positive regulation of re ceptor biosynthetic proce ss	IMP	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0016575	histone deacetylation	IEA	biological_process
GO:0016575	histone deacetylation	IMP	biological_process
GO:0016580	Sin3 complex	IDA	cellular_component
GO:0016581	NuRD complex	IDA	cellular_component
GO:0016581	NuRD complex	IDA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0019213	deacetylase activity	ISS	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0032041	NAD-dependent histone dea cetylase activity (H3-K14 specific)	IEA	molecular_function
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0033558	protein deacetylase activ ity	IMP	molecular_function
GO:0033613	activating transcription factor binding	IPI	molecular_function
GO:0042475	odontogenesis of dentin-c ontaining tooth	ISS	biological_process
GO:0042733	embryonic digit morphogen esis	ISS	biological_process
GO:0042826	histone deacetylase bindi ng	IPI	molecular_function
GO:0043044	ATP-dependent chromatin r emodeling	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	ISS	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043922	negative regulation by ho st of viral transcription	IMP	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0047485	protein N-terminus bindin g	IDA	molecular_function
GO:0048511	rhythmic process	IEA	biological_process
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0060766	negative regulation of an drogen receptor signaling pathway	IDA	biological_process
GO:0060789	hair follicle placode for mation	ISS	biological_process
GO:0061029	eyelid development in cam era-type eye	ISS	biological_process
GO:0061198	fungiform papilla formati on	ISS	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0070932	histone H3 deacetylation	IDA	biological_process
GO:0070933	histone H4 deacetylation	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IGI	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological_process
GO:0010832	negative regulation of my otube differentiation	IMP	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0031492	nucleosomal DNA binding	IDA	molecular_function
GO:0000118	histone deacetylase compl ex	TAS	cellular_component
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	TAS	biological_process
GO:0000785	chromatin	IDA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular_function
GO:0001047	core promoter binding	IDA	molecular_function
GO:0001085	RNA polymerase II transcr iption factor binding	IPI	molecular_function
GO:0001103	RNA polymerase II repress ing transcription factor binding	IPI	molecular_function
GO:0001106	RNA polymerase II transcr iption corepressor activi ty	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0004407	histone deacetylase activ ity	TAS	molecular_function
GO:0004407	histone deacetylase activ ity	IDA	molecular_function
GO:0004407	histone deacetylase activ ity	IMP	molecular_function
GO:0004407	histone deacetylase activ ity	IMP	molecular_function
GO:0004407	histone deacetylase activ ity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0006338	chromatin remodeling	IC	biological_process
GO:0006338	chromatin remodeling	IC	biological_process
GO:0006476	protein deacetylation	IDA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008134	transcription factor bind ing	TAS	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009913	epidermal cell differenti ation	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0010870	positive regulation of re ceptor biosynthetic proce ss	IMP	biological_process
GO:0016575	histone deacetylation	IMP	biological_process
GO:0016580	Sin3 complex	IDA	cellular_component
GO:0016581	NuRD complex	IDA	cellular_component
GO:0016581	NuRD complex	IDA	cellular_component
GO:0019213	deacetylase activity	ISS	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0033558	protein deacetylase activ ity	IDA	molecular_function
GO:0033558	protein deacetylase activ ity	IMP	molecular_function
GO:0033613	activating transcription factor binding	IPI	molecular_function
GO:0042475	odontogenesis of dentin-c ontaining tooth	ISS	biological_process
GO:0042733	embryonic digit morphogen esis	ISS	biological_process
GO:0042826	histone deacetylase bindi ng	IPI	molecular_function
GO:0043044	ATP-dependent chromatin r emodeling	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	ISS	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043922	negative regulation by ho st of viral transcription	IMP	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045892	negative regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0047485	protein N-terminus bindin g	IDA	molecular_function
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0060766	negative regulation of an drogen receptor signaling pathway	IDA	biological_process
GO:0060789	hair follicle placode for mation	ISS	biological_process
GO:0061029	eyelid development in cam era-type eye	ISS	biological_process
GO:0061198	fungiform papilla formati on	ISS	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0070932	histone H3 deacetylation	IDA	biological_process
GO:0070933	histone H4 deacetylation	IDA	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IGI	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological_process
GO:0010832	negative regulation of my otube differentiation	IMP	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0031492	nucleosomal DNA binding	IDA	molecular_function

KEGG pathways

hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
PTHR10625:SF109  p53 pathway
hsa05169  Epstein-Barr virus infection
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa04919  Thyroid hormone signaling pathway
hsa05016  Huntington's disease
hsa04110  Cell cycle
hsa05220  Chronic myeloid leukemia
hsa05034  Alcoholism
hsa04213  Longevity regulating pathway
hsa04330  Notch signaling pathway
hsa05031  Amphetamine addiction
PTHR10625:SF109  p53 pathway

Diseases

Associated diseases	References
Cancer	PMID: 19064572
Endometriosis	PMID: 23080547
Huntington's disease	PMID: 19683447
Endometriosis	INFBASE22344732

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
23080547	Endometrio sis	15 patients wit h endometriosis	SIRT1 HDAC1 SUV39H1 SUV39H2 HDAC2 G9a	Show abstract
22344732	Endometrio sis		HDAC1 HDAC2	Show abstract
23690335	Endometrio sis	104 (74 endomet riosis samples (27 ovarian end ometriosis, 19 peritoneal endo metriosis, 28 d eep- infiltrati ng endometriosi s), 30 normal e ndometrium cont rols)	HDAC-1 HDAC-2/-3	Show abstract