Endometriosis Knowledgebase

Search Result

Gene id

302

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ANXA2 Gene UCSC Ensembl

Aliases

ANX2, ANX2L4, CAL1H, HEL-S-270, LIP2, LPC2, LPC2D, P36, PAP-IV

Gene name

annexin A2

Alternate names

annexin A2, annexin II, annexin-2, calpactin I heavy chain, calpactin I heavy polypeptide, calpactin-1 heavy chain, chromobindin 8, epididymis secretory protein Li 270, lipocortin II, placental anticoagulant protein IV, protein I,

Gene location

15q22.2 (60398024: 60347150) Exons: 16 NC_000015.10

Gene summary(Entrez)

This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

OMIM

151740

Protein Summary

Protein general information

P07355

Name: Annexin A2 (Annexin II) (Annexin 2) (Calpactin I heavy chain) (Calpactin 1 heavy chain) (Chromobindin 8) (Lipocortin II) (Placental anticoagulant protein IV) (PAP IV) (Protein I) (p36)

Length: 339 Mass: 38,604

Sequence

MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAY
QRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEM
YKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHL
QKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Structural information

Interpro:	IPR001464 IPR018502 IPR018252 IPR002389
Prosite:	PS00223
Pfam:	PF00191
PDB:	1W7B 1XJL 2HYU 2HYV 2HYW 4DRW 4FTG 4HRH
PDBsum:	1W7B 1XJL 2HYU 2HYV 2HYW 4DRW 4FTG 4HRH
MINT:	1213203
STRING:	ENSP00000346032;

Other Databases

GeneCards: ANXA2; Malacards: ANXA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEP	biological_process
GO:0001726	ruffle	IEA	cellular_component
GO:0001765	membrane raft assembly	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0002020	protease binding	IPI	molecular_function
GO:0002091	negative regulation of re ceptor internalization	IDA	biological_process
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005544	calcium-dependent phospho lipid binding	IDA	molecular_function
GO:0005546	phosphatidylinositol-4,5- bisphosphate binding	IMP	molecular_function
GO:0005604	basement membrane	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005768	endosome	IDA	cellular_component
GO:0005769	early endosome	IEA	cellular_component
GO:0005811	lipid particle	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005938	cell cortex	IEA	cellular_component
GO:0006900	membrane budding	IMP	biological_process
GO:0007589	body fluid secretion	IEA	biological_process
GO:0008092	cytoskeletal protein bind ing	IEA	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016323	basolateral plasma membra ne	ISS	cellular_component
GO:0017137	Rab GTPase binding	IEA	molecular_function
GO:0019834	phospholipase A2 inhibito r activity	IDA	molecular_function
GO:0019897	extrinsic component of pl asma membrane	IEA	cellular_component
GO:0030199	collagen fibril organizat ion	IEA	biological_process
GO:0030496	midbody	IDA	cellular_component
GO:0031340	positive regulation of ve sicle fusion	IDA	biological_process
GO:0031902	late endosome membrane	IDA	cellular_component
GO:0031982	vesicle	IDA	cellular_component
GO:0032804	negative regulation of lo w-density lipoprotein par ticle receptor catabolic process	IDA	biological_process
GO:0035749	myelin sheath adaxonal re gion	IEA	cellular_component
GO:0036035	osteoclast development	IDA	biological_process
GO:0042383	sarcolemma	IEA	cellular_component
GO:0042470	melanosome	IEA	cellular_component
GO:0042730	fibrinolysis	IEA	biological_process
GO:0043086	negative regulation of ca talytic activity	IEA	biological_process
GO:0043220	Schmidt-Lanterman incisur e	IEA	cellular_component
GO:0044354	macropinosome	IEA	cellular_component
GO:0044548	S100 protein binding	IPI	molecular_function
GO:0044548	S100 protein binding	IPI	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IEA	biological_process
GO:0048306	calcium-dependent protein binding	IPI	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0051099	positive regulation of bi nding	IEA	biological_process
GO:0051290	protein heterotetrameriza tion	IDA	biological_process
GO:0051290	protein heterotetrameriza tion	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0072661	protein targeting to plas ma membrane	IEA	biological_process
GO:0097066	response to thyroid hormo ne	IEA	biological_process
GO:1900121	negative regulation of re ceptor binding	IDA	biological_process
GO:1990667	PCSK9-AnxA2 complex	IDA	cellular_component
GO:2000273	positive regulation of re ceptor activity	IMP	biological_process
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0045121	membrane raft	IDA	cellular_component
GO:0030546	receptor activator activi ty	IDA	molecular_function
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	IEP	biological_process
GO:0001726	ruffle	IEA	cellular_component
GO:0001765	membrane raft assembly	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0002020	protease binding	IPI	molecular_function
GO:0002091	negative regulation of re ceptor internalization	IEA	biological_process
GO:0002091	negative regulation of re ceptor internalization	IDA	biological_process
GO:0003723	RNA binding	IEA	molecular_function
GO:0004859	phospholipase inhibitor a ctivity	IEA	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005544	calcium-dependent phospho lipid binding	IEA	molecular_function
GO:0005544	calcium-dependent phospho lipid binding	IEA	molecular_function
GO:0005544	calcium-dependent phospho lipid binding	IDA	molecular_function
GO:0005546	phosphatidylinositol-4,5- bisphosphate binding	IEA	molecular_function
GO:0005546	phosphatidylinositol-4,5- bisphosphate binding	IMP	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005604	basement membrane	IEA	cellular_component
GO:0005604	basement membrane	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005768	endosome	IDA	cellular_component
GO:0005769	early endosome	IEA	cellular_component
GO:0005811	lipid particle	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005938	cell cortex	IEA	cellular_component
GO:0006900	membrane budding	IMP	biological_process
GO:0007589	body fluid secretion	IEA	biological_process
GO:0008092	cytoskeletal protein bind ing	IEA	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016323	basolateral plasma membra ne	IEA	cellular_component
GO:0016323	basolateral plasma membra ne	ISS	cellular_component
GO:0017137	Rab GTPase binding	IEA	molecular_function
GO:0019834	phospholipase A2 inhibito r activity	IDA	molecular_function
GO:0019897	extrinsic component of pl asma membrane	IEA	cellular_component
GO:0030199	collagen fibril organizat ion	IEA	biological_process
GO:0030496	midbody	IDA	cellular_component
GO:0031340	positive regulation of ve sicle fusion	IDA	biological_process
GO:0031902	late endosome membrane	IDA	cellular_component
GO:0031982	vesicle	IEA	cellular_component
GO:0031982	vesicle	IDA	cellular_component
GO:0032804	negative regulation of lo w-density lipoprotein par ticle receptor catabolic process	IEA	biological_process
GO:0032804	negative regulation of lo w-density lipoprotein par ticle receptor catabolic process	IDA	biological_process
GO:0035749	myelin sheath adaxonal re gion	IEA	cellular_component
GO:0036035	osteoclast development	IDA	biological_process
GO:0042383	sarcolemma	IEA	cellular_component
GO:0042470	melanosome	IEA	cellular_component
GO:0042730	fibrinolysis	IEA	biological_process
GO:0043086	negative regulation of ca talytic activity	IEA	biological_process
GO:0043220	Schmidt-Lanterman incisur e	IEA	cellular_component
GO:0043234	protein complex	IEA	cellular_component
GO:0044354	macropinosome	IEA	cellular_component
GO:0044548	S100 protein binding	IPI	molecular_function
GO:0044548	S100 protein binding	IPI	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IEA	biological_process
GO:0048306	calcium-dependent protein binding	IPI	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0051099	positive regulation of bi nding	IEA	biological_process
GO:0051290	protein heterotetrameriza tion	IDA	biological_process
GO:0051290	protein heterotetrameriza tion	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0072661	protein targeting to plas ma membrane	IEA	biological_process
GO:0097066	response to thyroid hormo ne	IEA	biological_process
GO:1900121	negative regulation of re ceptor binding	IEA	biological_process
GO:1900121	negative regulation of re ceptor binding	IDA	biological_process
GO:1990667	PCSK9-AnxA2 complex	IDA	cellular_component
GO:2000273	positive regulation of re ceptor activity	IEA	biological_process
GO:2000273	positive regulation of re ceptor activity	IMP	biological_process
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0045121	membrane raft	IDA	cellular_component
GO:0030546	receptor activator activi ty	IDA	molecular_function
GO:0001525	angiogenesis	IEP	biological_process
GO:0001765	membrane raft assembly	IMP	biological_process
GO:0002020	protease binding	IPI	molecular_function
GO:0002091	negative regulation of re ceptor internalization	IDA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005544	calcium-dependent phospho lipid binding	IDA	molecular_function
GO:0005546	phosphatidylinositol-4,5- bisphosphate binding	IMP	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005768	endosome	IDA	cellular_component
GO:0005811	lipid particle	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006900	membrane budding	IMP	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016323	basolateral plasma membra ne	ISS	cellular_component
GO:0019834	phospholipase A2 inhibito r activity	IDA	molecular_function
GO:0030496	midbody	IDA	cellular_component
GO:0031340	positive regulation of ve sicle fusion	IDA	biological_process
GO:0031902	late endosome membrane	IDA	cellular_component
GO:0031982	vesicle	IDA	cellular_component
GO:0032804	negative regulation of lo w-density lipoprotein par ticle receptor catabolic process	IDA	biological_process
GO:0036035	osteoclast development	IDA	biological_process
GO:0044548	S100 protein binding	IPI	molecular_function
GO:0044548	S100 protein binding	IPI	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0048306	calcium-dependent protein binding	IPI	molecular_function
GO:0051290	protein heterotetrameriza tion	IDA	biological_process
GO:0051290	protein heterotetrameriza tion	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1900121	negative regulation of re ceptor binding	IDA	biological_process
GO:1990667	PCSK9-AnxA2 complex	IDA	cellular_component
GO:2000273	positive regulation of re ceptor activity	IMP	biological_process
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0045121	membrane raft	IDA	cellular_component
GO:0030546	receptor activator activi ty	IDA	molecular_function

Diseases

Associated diseases	References
Adenomyosis	PMID: 22493182
Asthenozoospermia	PMID: 22353264
Endometrial cancer	PMID: 25219463
Endometriosis	PMID: 23340055
Osteonecrosis	PMID: 15784727
Endometriosis	INFBASE23340055

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23340055	Endometrio sis			35 (20 with end ometriosis, 15 without endomet riosis)		annexin A2 PGE2	Show abstract