Endometriosis Knowledgebase

Search Result

Gene id

27242

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TNFRSF21 Gene UCSC Ensembl

Aliases

BM-018, CD358, DR6

Gene name

TNF receptor superfamily member 21

Alternate names

tumor necrosis factor receptor superfamily member 21, TNFR-related death receptor 6, death receptor 6,

Gene location

6p12.3 (47309975: 47231526) Exons: 7 NC_000006.12

Gene summary(Entrez)

This gene encodes a member of the tumor necrosis factor receptor superfamily. The encoded protein activates nuclear factor kappa-B and mitogen-activated protein kinase 8 (also called c-Jun N-terminal kinase 1), and induces cell apoptosis. Through its death domain, the encoded receptor interacts with tumor necrosis factor receptor type 1-associated death domain (TRADD) protein, which is known to mediate signal transduction of tumor necrosis factor receptors. Knockout studies in mice suggest that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. [provided by RefSeq, Jul 2013]

OMIM

605732

Protein Summary

Protein general information

O75509

Name: Tumor necrosis factor receptor superfamily member 21 (Death receptor 6) (CD antigen CD358)

Length: 655 Mass: 71,845

Tissue specificity: Detected in fetal spinal cord and in brain neurons, with higher levels in brain from Alzheimer disease patients (at protein level). Highly expressed in heart, brain, placenta, pancreas, lymph node, thymus and prostate. Detected at lowe

Sequence

MGTSPSSSTALASCSRIARRATATMIAGSLLLLGFLSTTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTY
VSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVC
PVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTLPSFSSSTSPSP
GTAIFPRPEHMETHEVPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNH
QQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHLPWMIVLFLLLVLVVIVVCSIRKSSR
TLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIYYCNGHGIDILKLVAAQVGSQWKDIYQFLCNASEREVAAFSN
GYTADHERAYAALQHWTIRGPEASLAQLISALRQHRRNDVVEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPS
PNAKLENSALLTVEPSPQDKNKGFFVDESEPLLRCDSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIF
DDMLHFLNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLL

Structural information

Protein Domains	Death. (415-498)
Interpro:	IPR011029 IPR000488 IPR001368 IPR022330 IPR034037 IPR034034 IPR011641
Prosite:	PS50017 PS00652 PS50050
Pfam:	PF00531 PF00020
CDD:	cd08778 cd10583
PDB:	2DBH 3QO4 3U3P 3U3Q 3U3S 3U3T 3U3V
PDBsum:	2DBH 3QO4 3U3P 3U3Q 3U3S 3U3T 3U3V
DIP:	53299
MINT:	8247609
STRING:	ENSP00000296861;

Other Databases

GeneCards: TNFRSF21; Malacards: TNFRSF21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001783	B cell apoptotic process	ISS	biological_process
GO:0002250	adaptive immune response	ISS	biological_process
GO:0005031	tumor necrosis factor-act ivated receptor activity	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006915	apoptotic process	IMP	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0006959	humoral immune response	ISS	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0030889	negative regulation of B cell proliferation	ISS	biological_process
GO:0031226	intrinsic component of pl asma membrane	ISS	cellular_component
GO:0031642	negative regulation of my elination	IMP	biological_process
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0033209	tumor necrosis factor-med iated signaling pathway	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042130	negative regulation of T cell proliferation	ISS	biological_process
GO:0042552	myelination	ISS	biological_process
GO:0042981	regulation of apoptotic p rocess	IBA	biological_process
GO:0048713	regulation of oligodendro cyte differentiation	ISS	biological_process
GO:0048713	regulation of oligodendro cyte differentiation	IBA	biological_process
GO:0050852	T cell receptor signaling pathway	ISS	biological_process
GO:0051402	neuron apoptotic process	ISS	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0097190	apoptotic signaling pathw ay	IBA	biological_process
GO:0097252	oligodendrocyte apoptotic process	ISS	biological_process
GO:2000663	negative regulation of in terleukin-5 secretion	ISS	biological_process
GO:2000666	negative regulation of in terleukin-13 secretion	ISS	biological_process
GO:2001180	negative regulation of in terleukin-10 secretion	ISS	biological_process
GO:0001783	B cell apoptotic process	IEA	biological_process
GO:0001783	B cell apoptotic process	ISS	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002250	adaptive immune response	ISS	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0005031	tumor necrosis factor-act ivated receptor activity	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	IMP	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0006959	humoral immune response	IEA	biological_process
GO:0006959	humoral immune response	ISS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030424	axon	IEA	cellular_component
GO:0030889	negative regulation of B cell proliferation	IEA	biological_process
GO:0030889	negative regulation of B cell proliferation	ISS	biological_process
GO:0031226	intrinsic component of pl asma membrane	IEA	cellular_component
GO:0031226	intrinsic component of pl asma membrane	ISS	cellular_component
GO:0031642	negative regulation of my elination	IMP	biological_process
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0033209	tumor necrosis factor-med iated signaling pathway	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042130	negative regulation of T cell proliferation	IEA	biological_process
GO:0042130	negative regulation of T cell proliferation	ISS	biological_process
GO:0042552	myelination	IEA	biological_process
GO:0042552	myelination	ISS	biological_process
GO:0042981	regulation of apoptotic p rocess	IBA	biological_process
GO:0048713	regulation of oligodendro cyte differentiation	IEA	biological_process
GO:0048713	regulation of oligodendro cyte differentiation	ISS	biological_process
GO:0048713	regulation of oligodendro cyte differentiation	IBA	biological_process
GO:0050852	T cell receptor signaling pathway	IEA	biological_process
GO:0050852	T cell receptor signaling pathway	ISS	biological_process
GO:0051402	neuron apoptotic process	IEA	biological_process
GO:0051402	neuron apoptotic process	ISS	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0097190	apoptotic signaling pathw ay	IBA	biological_process
GO:0097252	oligodendrocyte apoptotic process	IEA	biological_process
GO:0097252	oligodendrocyte apoptotic process	ISS	biological_process
GO:2000663	negative regulation of in terleukin-5 secretion	IEA	biological_process
GO:2000663	negative regulation of in terleukin-5 secretion	ISS	biological_process
GO:2000666	negative regulation of in terleukin-13 secretion	IEA	biological_process
GO:2000666	negative regulation of in terleukin-13 secretion	ISS	biological_process
GO:2001180	negative regulation of in terleukin-10 secretion	IEA	biological_process
GO:2001180	negative regulation of in terleukin-10 secretion	ISS	biological_process
GO:0001783	B cell apoptotic process	ISS	biological_process
GO:0002250	adaptive immune response	ISS	biological_process
GO:0005031	tumor necrosis factor-act ivated receptor activity	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IDA	cellular_component
GO:0006915	apoptotic process	IMP	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0006959	humoral immune response	ISS	biological_process
GO:0030889	negative regulation of B cell proliferation	ISS	biological_process
GO:0031226	intrinsic component of pl asma membrane	ISS	cellular_component
GO:0031642	negative regulation of my elination	IMP	biological_process
GO:0032496	response to lipopolysacch aride	IBA	biological_process
GO:0042127	regulation of cell prolif eration	IBA	biological_process
GO:0042130	negative regulation of T cell proliferation	ISS	biological_process
GO:0042552	myelination	ISS	biological_process
GO:0042981	regulation of apoptotic p rocess	IBA	biological_process
GO:0048713	regulation of oligodendro cyte differentiation	ISS	biological_process
GO:0048713	regulation of oligodendro cyte differentiation	IBA	biological_process
GO:0050852	T cell receptor signaling pathway	ISS	biological_process
GO:0051402	neuron apoptotic process	ISS	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IDA	biological_process
GO:0097190	apoptotic signaling pathw ay	IBA	biological_process
GO:0097252	oligodendrocyte apoptotic process	ISS	biological_process
GO:2000663	negative regulation of in terleukin-5 secretion	ISS	biological_process
GO:2000666	negative regulation of in terleukin-13 secretion	ISS	biological_process
GO:2001180	negative regulation of in terleukin-10 secretion	ISS	biological_process

KEGG pathways

hsa04060 Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Endometriosis	PMID: 24028773
Endometriosis	INFBASE24028773
Migraine disorders	PMID: 16378686
Panic disorder	PMID: 19165232

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24028773	Endometrio sis				Female infertility		Show abstract