Endometriosis Knowledgebase

Search Result

Gene id

23566

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

LPAR3 Gene UCSC Ensembl

Aliases

EDG7, Edg-7, GPCR, HOFNH30, LP-A3, LPA3, RP4-678I3

Gene name

lysophosphatidic acid receptor 3

Alternate names

lysophosphatidic acid receptor 3, LPA receptor 3, LPA receptor EDG7, LPA-3, calcium-mobilizing lysophosphatidic acid receptor LP-A3, endothelial cell differentiation gene 7, endothelial differentiation, lysophosphatidic acid G-protein-coupled receptor, 7, lysoph,

Gene location

1p22.3 (84893212: 84813402) Exons: 3 NC_000001.11

Gene summary(Entrez)

This gene encodes a member of the G protein-coupled receptor family, as well as the EDG family of proteins. This protein functions as a cellular receptor for lysophosphatidic acid and mediates lysophosphatidic acid-evoked calcium mobilization. This receptor couples predominantly to G(q/11) alpha proteins. [provided by RefSeq, Jul 2008]

OMIM

605106

Protein Summary

Protein general information

Q9UBY5

Name: Lysophosphatidic acid receptor 3 (LPA receptor 3) (LPA 3) (Lysophosphatidic acid receptor Edg 7)

Length: 353 Mass: 40,128

Tissue specificity: Most abundantly expressed in prostate, testes, pancreas, and heart, with moderate levels in lung and ovary. No detectable expression in brain, placenta, liver, skeletal muscle, kidney, spleen, thymus, small intestine, colon, or periphe

Sequence

MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRKFHFPFYYLLANLAAA
DFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNLLVIAVERHMSIMRMRVHSNLTKKRVTLLIL
LVWAIAIFMGAVPTLGWNCLCNISACSSLAPIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTS
GSISRRRTPMKLMKTVMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS

Structural information

Interpro:	IPR000276 IPR017452 IPR004065 IPR005385
Prosite:	PS00237 PS50262
Pfam:	PF00001
STRING:	ENSP00000359643;

Other Databases

GeneCards: LPAR3; Malacards: LPAR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activi ty	IEA	biological_process
GO:0001965	G-protein alpha-subunit b inding	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005543	phospholipid binding	IEA	molecular_function
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0008289	lipid binding	TAS	molecular_function
GO:0030424	axon	IEA	cellular_component
GO:0032060	bleb assembly	IEA	biological_process
GO:0048672	positive regulation of co llateral sprouting	IEA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	IEA	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IEA	biological_process
GO:0070915	lysophosphatidic acid rec eptor activity	IEA	molecular_function
GO:0000187	activation of MAPK activi ty	IEA	biological_process
GO:0001965	G-protein alpha-subunit b inding	IEA	molecular_function
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005543	phospholipid binding	IEA	molecular_function
GO:0005829	cytosol	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0008289	lipid binding	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030424	axon	IEA	cellular_component
GO:0032060	bleb assembly	IEA	biological_process
GO:0043410	positive regulation of MA PK cascade	IEA	biological_process
GO:0048672	positive regulation of co llateral sprouting	IEA	biological_process
GO:0051482	positive regulation of cy tosolic calcium ion conce ntration involved in phos pholipase C-activating G- protein coupled signaling pathway	IEA	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IEA	biological_process
GO:0070915	lysophosphatidic acid rec eptor activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0008289	lipid binding	TAS	molecular_function

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa04015  Rap1 signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04072  Phospholipase D signaling pathway

Diseases

Associated diseases	References
Diabetes	PMID: 18840781
Endometriosis	PMID: 18672236
Endometriosis	INFBASE18672236
Repeated implantation failure (RIF)	PMID: 19815191

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
18672236	Endometrio sis			47 (24 women wi th endometriosi s, 23 healthy v olunteers of si milar age)		GdA OPN LPA3 HOXA10	Show abstract