Endometriosis Knowledgebase

Search Result

Gene id

2324

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

FLT4 Gene UCSC Ensembl

Aliases

FLT-4, FLT41, LMPH1A, PCL, VEGFR-3, VEGFR3

Gene name

fms related tyrosine kinase 4

Alternate names

vascular endothelial growth factor receptor 3, fms-like tyrosine kinase 4, tyrosine-protein kinase receptor FLT4,

Gene location

5q35.3 (180650297: 180601505) Exons: 35 NC_000005.10

Gene summary(Entrez)

This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq, Jul 2008]

OMIM

136352

SNPs

rs4837864

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000671.2   g.116782154T>C
NC_000009.11   g.119544433T>C
NC_000009.12   g.116782154T>C
NG_021409.1   g.637885A>G
NM_014010.4   c.2243+23478A>G

Protein Summary

Protein general information

P35916

Name: Vascular endothelial growth factor receptor 3 (VEGFR 3) (EC 2.7.10.1) (Fms like tyrosine kinase 4) (FLT 4) (Tyrosine protein kinase receptor FLT4)

Length: 1363 Mass: 152,757

Tissue specificity: Detected in endothelial cells (at protein level). Widely expressed. Detected in fetal spleen, lung and brain. Detected in adult liver, muscle, thymus, placenta, lung, testis, ovary, prostate, heart, and kidney. {ECO

Sequence

MQRGAALCLRLWLCLGLLDGLVSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDS
EDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQPFINKPDTLLVNR
KDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLHDALYLQCETTWGDQDFLSNPFLVHIT
GNELYDIQLLPRKSLELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNV
SQHDLGSYVCKANNGIQRFRESTEVIVHENPFISVEWLKGPILEATAGDELVKLPVKLAAYPPPEFQWYKDGKAL
SGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNVPPQIHEKEASSPSIYSRHSRQALTCTAYGV
PLPLSIQWHWRPWTPCKMFAQRSLRRRQQQDLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQN
ANVSAMYKCVVSNKVGQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHD
AHGNPLLLDCKNVHLFATPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRSHDKHCHKKYLSVQAL
EAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEEKSGVDLADSNQKLSIQRVREEDAGRYLCSV
CNAKGCVNSSASVAVEGSEDKGSMEIVILVGTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLE
EQCEYLSYDASQWEFPRERLHLGRVLGYGAFGKVVEASAFGIHKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPQGPLMVIVEFCKYGNLSNFLRAKRDAFSPCAEKSPEQRGRFRAMVELARLDRRRPG
SSDRVLFARFSKTEGGARRASPDQEAEDLWLSPLTMEDLVCYSFQVARGMEFLASRKCIHRDLAARNILLSESDV
VKICDFGLARDIYKDPDYVRKGSARLPLKWMAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFC
QRLRDGTRMRAPELATPAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGRGLQEEEEVCMAPRSSQSSEEGSFS
QVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPMTPTTYKGSVDNQTDS
GMVLASEEFEQIESRHRQESGFSCKGPGQNVAVTRAHPDSQGRRRRPERGARGGQVFYNSEYGELSEPSEEDHCS
PSARVTFFTDNSY

Structural information

Protein Domains	Ig-like (30-127) Ig-like (151-213) Ig-like (219-326) Ig-like (331-415) Ig-like (422-552) Ig-like (555-671) Ig-like (678-764) (845-)
Interpro:	IPR007110 IPR013783 IPR013098 IPR003599 IPR003598 IPR011009 IPR000719 IPR017441 IPR001245 IPR008266 IPR020635 IPR001824 IPR009137
Prosite:	PS50835 PS00107 PS50011 PS00109 PS00240
Pfam:	PF07679 PF07714
PDB:	4BSJ 4BSK
PDBsum:	4BSJ 4BSK
DIP:	5739
MINT:	1182429
STRING:	ENSP00000261937;

Other Databases

GeneCards: FLT4; Malacards: FLT4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0001944	vasculature development	ISS	biological_process
GO:0001945	lymph vessel development	ISS	biological_process
GO:0001946	lymphangiogenesis	ISS	biological_process
GO:0001946	lymphangiogenesis	IMP	biological_process
GO:0002040	sprouting angiogenesis	ISS	biological_process
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IMP	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IMP	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IMP	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IGI	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IMP	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0038084	vascular endothelial grow th factor signaling pathw ay	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0043410	positive regulation of MA PK cascade	IMP	biological_process
GO:0046330	positive regulation of JN K cascade	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IGI	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048514	blood vessel morphogenesi s	ISS	biological_process
GO:0060312	regulation of blood vesse l remodeling	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0090037	positive regulation of pr otein kinase C signaling	IMP	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001525	angiogenesis	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0001944	vasculature development	IEA	biological_process
GO:0001944	vasculature development	ISS	biological_process
GO:0001945	lymph vessel development	IEA	biological_process
GO:0001945	lymph vessel development	ISS	biological_process
GO:0001946	lymphangiogenesis	IEA	biological_process
GO:0001946	lymphangiogenesis	ISS	biological_process
GO:0001946	lymphangiogenesis	IMP	biological_process
GO:0002040	sprouting angiogenesis	IEA	biological_process
GO:0002040	sprouting angiogenesis	ISS	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IMP	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IEA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IEA	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IMP	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IMP	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IEA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IGI	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IMP	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0038084	vascular endothelial grow th factor signaling pathw ay	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0043410	positive regulation of MA PK cascade	IMP	biological_process
GO:0046330	positive regulation of JN K cascade	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IEA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IGI	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048514	blood vessel morphogenesi s	IEA	biological_process
GO:0048514	blood vessel morphogenesi s	ISS	biological_process
GO:0060312	regulation of blood vesse l remodeling	IEA	biological_process
GO:0060312	regulation of blood vesse l remodeling	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0090037	positive regulation of pr otein kinase C signaling	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IMP	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IMP	biological_process
GO:0001944	vasculature development	ISS	biological_process
GO:0001945	lymph vessel development	ISS	biological_process
GO:0001946	lymphangiogenesis	ISS	biological_process
GO:0001946	lymphangiogenesis	IMP	biological_process
GO:0002040	sprouting angiogenesis	ISS	biological_process
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IMP	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	TAS	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IMP	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IMP	molecular_function
GO:0005021	vascular endothelial grow th factor-activated recep tor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IGI	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IMP	biological_process
GO:0010595	positive regulation of en dothelial cell migration	IMP	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IDA	biological_process
GO:0019838	growth factor binding	IPI	molecular_function
GO:0019903	protein phosphatase bindi ng	IPI	molecular_function
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0043410	positive regulation of MA PK cascade	IMP	biological_process
GO:0046330	positive regulation of JN K cascade	IMP	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IGI	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	IDA	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048514	blood vessel morphogenesi s	ISS	biological_process
GO:0060312	regulation of blood vesse l remodeling	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0090037	positive regulation of pr otein kinase C signaling	IMP	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa05224  Breast cancer

Diseases

Associated diseases	References
Cancer	PMID: 19924384
Endometrial cancer	PMID: 10831352
Endometriosis	PMID: 21733043
Lymphangioma	KEGG: H01471
Lymphedema	KEGG: H00535
Tubal infertility	INFBASE21733043
Endometriosis	INFBASE21733043

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21733043	Endometrio sis			40 (20 women wi th endometriosi s III or IV, 20 with tubal inf ertility only ( control group) )			Show abstract