Endometriosis Knowledgebase

Search Result

Gene id

2289

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

FKBP5 Gene UCSC Ensembl

Aliases

AIG6, FKBP51, FKBP54, P54, PPIase, Ptg-10

Gene name

FK506 binding protein 5

Alternate names

peptidyl-prolyl cis-trans isomerase FKBP5, 51 kDa FK506-binding protein, 51 kDa FKBP, 54 kDa progesterone receptor-associated immunophilin, FF1 antigen, FKBP-51, HSP90-binding immunophilin, PPIase FKBP5, T-cell FK506-binding protein, androgen-regulated protein 6, p,

Gene location

6p21.31 (35728582: 35573584) Exons: 13 NC_000006.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]

OMIM

602623

Protein Summary

Protein general information

Q13451

Name: Peptidyl prolyl cis trans isomerase FKBP5 (PPIase FKBP5) (EC 5.2.1.8) (51 kDa FK506 binding protein) (51 kDa FKBP) (FKBP 51) (54 kDa progesterone receptor associated immunophilin) (Androgen regulated protein 6) (FF1 antigen) (FK506 binding protein 5) (FKB

Length: 457 Mass: 51,212

Tissue specificity: Widely expressed, enriched in testis compared to other tissues.

Sequence

MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNE
PFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIR
RTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGF
GEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE
KVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEE
EKPEGHV

Structural information

Protein Domains	PPIase (42-130) PPIase (157-243)
Interpro:	IPR031210 IPR023566 IPR001179 IPR013026 IPR011990 IPR001440 IPR019734
Prosite:	PS50059 PS50005 PS50293
Pfam:	PF00254 PF00515 PF13181
PDB:	1KT0 3O5D 3O5E 3O5F 3O5G 3O5I 3O5J 3O5K 3O5L 3O5M 3O5O 3O5P 3O5Q 3O5R 4DRH 4DRI 4DRK 4DRM 4DRN 4DRO 4DRP 4DRQ 4JFI 4JFJ 4JFK 4JFL 4JFM 4R0X 4TW6 4TW7 4TX0 4W9O 4W9P 4W9Q 5BXJ 5DIT 5DIU 5DIV
PDBsum:	1KT0 3O5D 3O5E 3O5F 3O5G 3O5I 3O5J 3O5K 3O5L 3O5M 3O5O 3O5P 3O5Q 3O5R 4DRH 4DRI 4DRK 4DRM 4DRN 4DRO 4DRP 4DRQ 4JFI 4JFJ 4JFK 4JFL 4JFM 4R0X 4TW6 4TW7 4TX0 4W9O 4W9P 4W9Q 5BXJ 5DIT 5DIU 5DIV
DIP:	27597
MINT:	1142816
STRING:	ENSP00000338160;

Other Databases

GeneCards: FKBP5; Malacards: FKBP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000413	protein peptidyl-prolyl i somerization	IEA	biological_process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005528	FK506 binding	IEA	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IBA	cellular_component
GO:0006457	protein folding	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0031072	heat shock protein bindin g	IPI	molecular_function
GO:0061077	chaperone-mediated protei n folding	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0000413	protein peptidyl-prolyl i somerization	IEA	biological_process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular_function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular_function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular_function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005528	FK506 binding	IEA	molecular_function
GO:0005528	FK506 binding	TAS	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IBA	cellular_component
GO:0006457	protein folding	IEA	biological_process
GO:0006457	protein folding	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016853	isomerase activity	IEA	molecular_function
GO:0031072	heat shock protein bindin g	IEA	molecular_function
GO:0031072	heat shock protein bindin g	IPI	molecular_function
GO:0061077	chaperone-mediated protei n folding	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005528	FK506 binding	TAS	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IBA	cellular_component
GO:0006457	protein folding	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0031072	heat shock protein bindin g	IPI	molecular_function
GO:0061077	chaperone-mediated protei n folding	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa04915 Estrogen signaling pathway

Diseases

Associated diseases	References
Addison's disease	PMID: 19282465
Asthma	PMID: 19254810
Depression	KEGG: H01646
Endometriosis	PMID: 22279148
Inflammation	PMID: 19233472
Endometriosis	INFBASE22279148

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22279148	Endometrio sis					FKBP4 FKBP5 HOXA10	Show abstract