Endometriosis Knowledgebase

Search Result

Gene id

2207

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

FCER1G Gene UCSC Ensembl

Aliases

FCRG

Gene name

Fc fragment of IgE receptor Ig

Alternate names

high affinity immunoglobulin epsilon receptor subunit gamma, Fc epsilon receptor Ig, Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide, Fc receptor gamma-chain, fc-epsilon RI-gamma, fcRgamma, fceRI gamma, immunoglobulin E receptor, high affini,

Gene location

1q23.3 (161215296: 161219247) Exons: 5 NC_000001.11

Gene summary(Entrez)

The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]

OMIM

147139

Protein Summary

Protein general information

P30273

Name: High affinity immunoglobulin epsilon receptor subunit gamma (Fc receptor gamma chain) (FcRgamma) (Fc epsilon RI gamma) (IgE Fc receptor subunit gamma) (FceRI gamma)

Length: 86 Mass: 9,667

Sequence

MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQET
YETLKHEKPPQ

Structural information

Protein Domains	ITAM. (54-82)
Interpro:	IPR021663 IPR003110
Prosite:	PS51055
Pfam:	PF02189 PF11628
DIP:	29514
MINT:	6622796
STRING:	ENSP00000289902;

Other Databases

GeneCards: FCER1G; Malacards: FCER1G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001798	positive regulation of ty pe IIa hypersensitivity	IEA	biological_process
GO:0001805	positive regulation of ty pe III hypersensitivity	IEA	biological_process
GO:0001812	positive regulation of ty pe I hypersensitivity	IEA	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002283	neutrophil activation inv olved in immune response	IBA	biological_process
GO:0002292	T cell differentiation in volved in immune response	IBA	biological_process
GO:0002431	Fc receptor mediated stim ulatory signaling pathway	IBA	biological_process
GO:0002554	serotonin secretion by pl atelet	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0006911	phagocytosis, engulfment	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0009897	external side of plasma m embrane	IBA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010543	regulation of platelet ac tivation	IBA	biological_process
GO:0016064	immunoglobulin mediated i mmune response	IBA	biological_process
GO:0019767	IgE receptor activity	IBA	molecular_function
GO:0019863	IgE binding	IBA	molecular_function
GO:0019864	IgG binding	IBA	molecular_function
GO:0019886	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass II	IBA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0031623	receptor internalization	ISS	biological_process
GO:0032733	positive regulation of in terleukin-10 production	IEA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032765	positive regulation of ma st cell cytokine producti on	IEA	biological_process
GO:0032998	Fc-epsilon receptor I com plex	IBA	cellular_component
GO:0033026	negative regulation of ma st cell apoptotic process	IEA	biological_process
GO:0038094	Fc-gamma receptor signali ng pathway	IBA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0042590	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I	IBA	biological_process
GO:0042742	defense response to bacte rium	IBA	biological_process
GO:0043306	positive regulation of ma st cell degranulation	IEA	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0045576	mast cell activation	IEA	biological_process
GO:0050766	positive regulation of ph agocytosis	IBA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological_process
GO:0072659	protein localization to p lasma membrane	IEA	biological_process
GO:0001798	positive regulation of ty pe IIa hypersensitivity	IEA	biological_process
GO:0001805	positive regulation of ty pe III hypersensitivity	IEA	biological_process
GO:0001812	positive regulation of ty pe I hypersensitivity	IEA	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002283	neutrophil activation inv olved in immune response	IEA	biological_process
GO:0002283	neutrophil activation inv olved in immune response	IBA	biological_process
GO:0002292	T cell differentiation in volved in immune response	IEA	biological_process
GO:0002292	T cell differentiation in volved in immune response	IBA	biological_process
GO:0002431	Fc receptor mediated stim ulatory signaling pathway	IEA	biological_process
GO:0002431	Fc receptor mediated stim ulatory signaling pathway	IBA	biological_process
GO:0002554	serotonin secretion by pl atelet	IEA	biological_process
GO:0004888	transmembrane signaling r eceptor activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0006911	phagocytosis, engulfment	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007166	cell surface receptor sig naling pathway	IEA	biological_process
GO:0007166	cell surface receptor sig naling pathway	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009897	external side of plasma m embrane	IBA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010543	regulation of platelet ac tivation	IEA	biological_process
GO:0010543	regulation of platelet ac tivation	IBA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016064	immunoglobulin mediated i mmune response	IEA	biological_process
GO:0016064	immunoglobulin mediated i mmune response	IBA	biological_process
GO:0019767	IgE receptor activity	IEA	molecular_function
GO:0019767	IgE receptor activity	IBA	molecular_function
GO:0019863	IgE binding	IEA	molecular_function
GO:0019863	IgE binding	IBA	molecular_function
GO:0019863	IgE binding	IEA	molecular_function
GO:0019864	IgG binding	IEA	molecular_function
GO:0019864	IgG binding	IBA	molecular_function
GO:0019886	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass II	IEA	biological_process
GO:0019886	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass II	IBA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030593	neutrophil chemotaxis	IEA	biological_process
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0031623	receptor internalization	IEA	biological_process
GO:0031623	receptor internalization	ISS	biological_process
GO:0032733	positive regulation of in terleukin-10 production	IEA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032765	positive regulation of ma st cell cytokine producti on	IEA	biological_process
GO:0032998	Fc-epsilon receptor I com plex	IEA	cellular_component
GO:0032998	Fc-epsilon receptor I com plex	IBA	cellular_component
GO:0033026	negative regulation of ma st cell apoptotic process	IEA	biological_process
GO:0038094	Fc-gamma receptor signali ng pathway	IEA	biological_process
GO:0038094	Fc-gamma receptor signali ng pathway	IBA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	IEA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0042590	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I	IEA	biological_process
GO:0042590	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I	IBA	biological_process
GO:0042742	defense response to bacte rium	IEA	biological_process
GO:0042742	defense response to bacte rium	IBA	biological_process
GO:0043306	positive regulation of ma st cell degranulation	IEA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0045576	mast cell activation	IEA	biological_process
GO:0050766	positive regulation of ph agocytosis	IEA	biological_process
GO:0050766	positive regulation of ph agocytosis	IBA	biological_process
GO:0050776	regulation of immune resp onse	IEA	biological_process
GO:0050778	positive regulation of im mune response	IEA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	IEA	biological_process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological_process
GO:0072659	protein localization to p lasma membrane	IEA	biological_process
GO:0002223	stimulatory C-type lectin receptor signaling pathw ay	TAS	biological_process
GO:0002283	neutrophil activation inv olved in immune response	IBA	biological_process
GO:0002292	T cell differentiation in volved in immune response	IBA	biological_process
GO:0002431	Fc receptor mediated stim ulatory signaling pathway	IBA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007596	blood coagulation	TAS	biological_process
GO:0009897	external side of plasma m embrane	IBA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010543	regulation of platelet ac tivation	IBA	biological_process
GO:0016064	immunoglobulin mediated i mmune response	IBA	biological_process
GO:0019767	IgE receptor activity	IBA	molecular_function
GO:0019863	IgE binding	IBA	molecular_function
GO:0019864	IgG binding	IBA	molecular_function
GO:0019886	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass II	IBA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0030593	neutrophil chemotaxis	IBA	biological_process
GO:0031623	receptor internalization	ISS	biological_process
GO:0032998	Fc-epsilon receptor I com plex	IBA	cellular_component
GO:0038094	Fc-gamma receptor signali ng pathway	IBA	biological_process
GO:0038095	Fc-epsilon receptor signa ling pathway	TAS	biological_process
GO:0042590	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I	IBA	biological_process
GO:0042742	defense response to bacte rium	IBA	biological_process
GO:0045087	innate immune response	IBA	biological_process
GO:0050766	positive regulation of ph agocytosis	IBA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological_process

KEGG pathways

hsa05152  Tuberculosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa04072  Phospholipase D signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa05310  Asthma

Diseases

Associated diseases	References
Endometriosis (ovarian)	PMID: 15005245
Asthma	PMID: 11202474
Cardiovascular disease	PMID: 12116890
Eczema	PMID: 20028371
Nephrotic syndrome	PMID: 11980568
Ovarian endometriosis	PMID: 15005245
Ovarian endometriosis	PMID: 15005245
Ovarian endometriosis	INFBASE15005245
Systemic lupus erythematosus	PMID: 11898918

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
15005245	Endometrio sis (ovari an)					FCER1G PGDS IL-8 GRO1 GRO2 CXCR4 MCP1 MMP COL4A2 and COL5A2	Show abstract