Endometriosis Knowledgebase

Search Result

Gene id

1958

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

EGR1 Gene UCSC Ensembl

Aliases

AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225

Gene name

early growth response 1

Alternate names

early growth response protein 1, EGR-1, nerve growth factor-induced protein A, transcription factor ETR103, transcription factor Zif268, zinc finger protein 225, zinc finger protein Krox-24,

Gene location

5q31.2 (138465491: 138469314) Exons: 2 NC_000005.10

Gene summary(Entrez)

The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppressor gene. [provided by RefSeq, Dec 2014]

OMIM

128990

Protein Summary

Protein general information

P18146

Name: Early growth response protein 1 (EGR 1) (AT225) (Nerve growth factor induced protein A) (NGFI A) (Transcription factor ETR103) (Transcription factor Zif268) (Zinc finger protein 225) (Zinc finger protein Krox 24)

Length: 543 Mass: 57,507

Tissue specificity: Detected in neutrophils (at protein level). {ECO

Sequence

MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGG
GSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLW
PEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAF
PGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMR
NFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVASSATSSLSSYPSPVATSY
PSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSAS
TGLSDMTATFSPRTIEIC

Structural information

Interpro:	IPR021839 IPR021849 IPR013087 IPR013083
Prosite:	PS00028 PS50157
Pfam:	PF11914 PF11928
PDB:	4R2A 4R2C 4R2D 4X9J
PDBsum:	4R2A 4R2C 4R2D 4X9J
MINT:	234136
STRING:	ENSP00000239938;

Other Databases

GeneCards: EGR1; Malacards: EGR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular_function
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IDA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	IDA	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0030217	T cell differentiation	IEA	biological_process
GO:0030509	BMP signaling pathway	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0033233	regulation of protein sum oylation	IDA	biological_process
GO:0035035	histone acetyltransferase binding	IPI	molecular_function
GO:0035914	skeletal muscle cell diff erentiation	IEA	biological_process
GO:0042981	regulation of apoptotic p rocess	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0060337	type I interferon signali ng pathway	TAS	biological_process
GO:0061418	regulation of transcripti on from RNA polymerase II promoter in response to hypoxia	IEA	biological_process
GO:0070498	interleukin-1-mediated si gnaling pathway	IMP	biological_process
GO:0071480	cellular response to gamm a radiation	IEA	biological_process
GO:0071504	cellular response to hepa rin	ISS	biological_process
GO:0071506	cellular response to myco phenolic acid	ISS	biological_process
GO:0072110	glomerular mesangial cell proliferation	ISS	biological_process
GO:0072303	positive regulation of gl omerular metanephric mesa ngial cell proliferation	ISS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular_function
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IEA	molecular_function
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IDA	molecular_function
GO:0000982	transcription factor acti vity, RNA polymerase II c ore promoter proximal reg ion sequence-specific bin ding	IEA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0003676	nucleic acid binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IDA	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0030217	T cell differentiation	IEA	biological_process
GO:0030509	BMP signaling pathway	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0033233	regulation of protein sum oylation	IDA	biological_process
GO:0035035	histone acetyltransferase binding	IPI	molecular_function
GO:0035914	skeletal muscle cell diff erentiation	IEA	biological_process
GO:0042981	regulation of apoptotic p rocess	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IEA	molecular_function
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0060337	type I interferon signali ng pathway	TAS	biological_process
GO:0061418	regulation of transcripti on from RNA polymerase II promoter in response to hypoxia	IEA	biological_process
GO:0070498	interleukin-1-mediated si gnaling pathway	IMP	biological_process
GO:0071310	cellular response to orga nic substance	IEA	biological_process
GO:0071480	cellular response to gamm a radiation	IEA	biological_process
GO:0071504	cellular response to hepa rin	ISS	biological_process
GO:0071506	cellular response to myco phenolic acid	ISS	biological_process
GO:0072110	glomerular mesangial cell proliferation	ISS	biological_process
GO:0072303	positive regulation of gl omerular metanephric mesa ngial cell proliferation	ISS	biological_process
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular_function
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IDA	molecular_function
GO:0003677	DNA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	IDA	biological_process
GO:0033233	regulation of protein sum oylation	IDA	biological_process
GO:0035035	histone acetyltransferase binding	IPI	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0060337	type I interferon signali ng pathway	TAS	biological_process
GO:0070498	interleukin-1-mediated si gnaling pathway	IMP	biological_process
GO:0071504	cellular response to hepa rin	ISS	biological_process
GO:0071506	cellular response to myco phenolic acid	ISS	biological_process
GO:0072110	glomerular mesangial cell proliferation	ISS	biological_process
GO:0072303	positive regulation of gl omerular metanephric mesa ngial cell proliferation	ISS	biological_process

KEGG pathways

hsa05166  HTLV-I infection
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04371  Apelin signaling pathway
hsa05020  Prion diseases
PTHR44685:SF1  CCKR signaling map

Diseases

Associated diseases	References
Asthma	PMID: 18507785
Endometriosis	PMID: 23427178
Myopia	PMID: 18636116
Ovulatory dysfunction	PMID: 23427178
Ovulatory dysfunction in endometriosis	INFBASE23427178
Endometriosis	INFBASE23427178
Rhinitis	PMID: 19833116

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23427178	Endometrio sis					TNFA EGR1	Show abstract