Endometriosis Knowledgebase

Search Result

Gene id

1434

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CSE1L Gene UCSC Ensembl

Aliases

CAS, CSE1, XPO2

Gene name

chromosome segregation 1 like

Alternate names

exportin-2, CSE1 chromosome segregation 1-like, cellular apoptosis susceptibility protein, chromosome segregation 1-like protein, exp2, importin-alpha re-exporter,

Gene location

20q13.13 (46105075: 46053065) Exons: 12 NC_000013.11

Gene summary(Entrez)

Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]

OMIM

601342

Protein Summary

Protein general information

P55060

Name: Exportin-2 (Exp2) (Cellular apoptosis susceptibility protein) (Chromosome segregation 1-like protein) (Importin-alpha re-exporter)

Length: 971 Mass: 1,10,417

Tissue specificity: Detected in brain, placenta, ovary, testis and trachea (at protein level) (PubMed

Sequence

MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLEKSQDNVIKVCASVTFKNYIKRNWR
IVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGREDFPQKWPDLLTEMVNRFQSGDFHVINGVL
RTAHSLFKRYRHEFKSNELWTEIKLVLDAFALPLTNLFKATIELCSTHANDASALRILFSSLILISKLFYSLNFQ
DLPEFFEDNMETWMNNFHTLLTLDNKLLQTDDEEEAGLLELLKSQICDNAALYAQKYDEEFQRYLPRFVTAIWNL
LVTTGQEVKYDLLVSNAIQFLASVCERPHYKNLFEDQNTLTSICEKVIVPNMEFRAADEEAFEDNSEEYIRRDLE
GSDIDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNPSVNWKHKDAAIYLVTSLASKAQTQKHGITQ
ANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMIFRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHA
LERLFTMRGPNNATLFTAAEIAPFVEILLTNLFKALTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTLITQLTQ
KLLAVSKNPSKPHFNHYMFEAICLSIRITCKANPAAVVNFEEALFLVFTEILQNDVQEFIPYVFQVMSLLLETHK
NDIPSSYMALFPHLLQPVLWERTGNIPALVRLLQAFLERGSNTIASAAADKIPGLLGVFQKLIASKANDHQGFYL
LNSIIEHMPPESVDQYRKQIFILLFQRLQNSKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKI
IIPEIQKVSGNVEKKICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDTIPDEEHFIDIEDTPGYQ
TAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL

Structural information

Protein Domains	Importin (29-102)
Interpro:	IPR011989 IPR016024 IPR005043 IPR013713 IPR001494
Prosite:	PS50166
Pfam:	PF03378 PF08506 PF03810
DIP:	32573
MINT:
STRING:	ENSP00000262982;

Other Databases

GeneCards: CSE1L; Malacards: CSE1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005049	nuclear export signal rec eptor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	TAS	cellular_component
GO:0005635	nuclear envelope	IBA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IBA	cellular_component
GO:0006606	protein import into nucle us	IBA	biological_process
GO:0006611	protein export from nucle us	IEA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008536	Ran GTPase binding	IEA	molecular_function
GO:0016020	membrane	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0005049	nuclear export signal rec eptor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	TAS	cellular_component
GO:0005635	nuclear envelope	IBA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005829	cytosol	IBA	cellular_component
GO:0006606	protein import into nucle us	IBA	biological_process
GO:0006611	protein export from nucle us	IEA	biological_process
GO:0006810	transport	IEA	biological_process
GO:0006886	intracellular protein tra nsport	IEA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008536	Ran GTPase binding	IEA	molecular_function
GO:0015031	protein transport	IEA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0005049	nuclear export signal rec eptor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	TAS	cellular_component
GO:0005635	nuclear envelope	IBA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005829	cytosol	IBA	cellular_component
GO:0006606	protein import into nucle us	IBA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	INFBASE29630856

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
29630856	Endometrio sis					CAS CD147 nuclearB-cat	Show abstract