Endometriosis Knowledgebase

Search Result

Gene id

1401

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CRP Gene UCSC Ensembl

Aliases

PTX1

Gene name

C-reactive protein

Alternate names

C-reactive protein, C-reactive protein, pentraxin-related, pentraxin 1,

Gene location

1q23.2 (159714622: 159712288) Exons: 3 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. [provided by RefSeq, Sep 2009]

OMIM

123260

Protein Summary

Protein general information

P02741

Name: C reactive protein [Cleaved into: C reactive protein(1 205)]

Length: 224 Mass: 25,039

Tissue specificity: Found in plasma.

Sequence

MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATK
RQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEAS
IILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP

Structural information

Protein Domains	Pentraxin (23-224)
Interpro:	IPR013320 IPR030476 IPR001759
Prosite:	PS00289 PS51828
Pfam:	PF00354
CDD:	cd00152
PDB:	1B09 1CRV 1GNH 1LJ7 3L2Y 3PVN 3PVO
PDBsum:	1B09 1CRV 1GNH 1LJ7 3L2Y 3PVN 3PVO
DIP:	39125
MINT:	1206167
STRING:	ENSP00000255030;

Other Databases

GeneCards: CRP; Malacards: CRP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001849	complement component C1q binding	IDA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006953	acute-phase response	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0008228	opsonization	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IDA	biological_process
GO:0010888	negative regulation of li pid storage	IDA	biological_process
GO:0030169	low-density lipoprotein p article binding	IDA	molecular_function
GO:0032930	positive regulation of su peroxide anion generation	IDA	biological_process
GO:0033265	choline binding	TAS	molecular_function
GO:0045908	negative regulation of va sodilation	IDA	biological_process
GO:0045908	negative regulation of va sodilation	IMP	biological_process
GO:0050750	low-density lipoprotein p article receptor binding	IPI	molecular_function
GO:0050830	defense response to Gram- positive bacterium	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2000482	regulation of interleukin -8 secretion	IDA	biological_process
GO:0046790	virion binding	IDA	molecular_function
GO:0001849	complement component C1q binding	IDA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006953	acute-phase response	IEA	biological_process
GO:0006953	acute-phase response	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0008228	opsonization	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IDA	biological_process
GO:0010888	negative regulation of li pid storage	IDA	biological_process
GO:0030169	low-density lipoprotein p article binding	IDA	molecular_function
GO:0032930	positive regulation of su peroxide anion generation	IDA	biological_process
GO:0033265	choline binding	TAS	molecular_function
GO:0045908	negative regulation of va sodilation	IDA	biological_process
GO:0045908	negative regulation of va sodilation	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0050750	low-density lipoprotein p article receptor binding	IPI	molecular_function
GO:0050830	defense response to Gram- positive bacterium	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2000482	regulation of interleukin -8 secretion	IDA	biological_process
GO:0046790	virion binding	IDA	molecular_function
GO:0001849	complement component C1q binding	IDA	molecular_function
GO:0005509	calcium ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006953	acute-phase response	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0008228	opsonization	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IDA	biological_process
GO:0010888	negative regulation of li pid storage	IDA	biological_process
GO:0030169	low-density lipoprotein p article binding	IDA	molecular_function
GO:0032930	positive regulation of su peroxide anion generation	IDA	biological_process
GO:0033265	choline binding	TAS	molecular_function
GO:0045908	negative regulation of va sodilation	IDA	biological_process
GO:0045908	negative regulation of va sodilation	IMP	biological_process
GO:0050750	low-density lipoprotein p article receptor binding	IPI	molecular_function
GO:0050830	defense response to Gram- positive bacterium	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:2000482	regulation of interleukin -8 secretion	IDA	biological_process
GO:0046790	virion binding	IDA	molecular_function

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 15286457
Arthritis	PMID: 17596285
Cancer	PMID: 17114654
Chronic anovulation	PMID: 22344731
Chronic kidney failure	PMID: 19578796
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Chronic prostatitis	PMID: 6859561
Connective tissue diseases	PMID: 19527514
Crohn's disease	PMID: 16344720
Depression	PMID: 19433520
Diabetes	PMID: 12618085
Endometrial cancer	PMID: 23702681
Endometriosis	PMID: 24488583
Endometriosis	PMID: 23833592
Endometriosis	PMID: 24702902
Endometriosis	PMID: 20537326
Erectile dysfunction	PMID: 22973171
Hyperandrogenism	PMID: 24347428
Implantation failure	PMID: 26952510
Inflammation	PMID: 19929715
Macular degeneration	PMID: 16723442
Myocardial infarction	PMID: 18385179
Obesity	PMID: 19101671
Ovarian hyperstimulation syndrome (OHSS)	PMID: 20170348
Pelvic endometriosis	PMID: 9436699
Polycystic ovary syndrome (PCOS)	PMID: 23116196
Polycystic ovary syndrome (PCOS)	PMID: 21627426
Preeclampsia	PMID: 23905607
Primary ovarian insufficiency (POI)	PMID: 25647778
Pulmonary disease	PMID: 19272152
Recurrent miscarriage	PMID: 26952510
Endometriosis	INFBASE19230253
Pelvic endometriosis	INFBASE9436699
Endometriosis	INFBASE24488583
Systemic lupus erythematosus	KEGG: H00080, PMID: 19755616

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
24488583	Endometrio sis	86 (50 patients with surgicall y proven endome triosis, 36 pat ients without e ndometriosis co mprised the con trol group)	Female infertility		Show abstract
23833592	Endometrio sis	179 (90 with en dometriosis, 89 without endome triosis)			Show abstract
19230253	Endometrio sis	50 (15 women wi thout endometri osis, as confir med by laparosc opy (group A), 35 patients wit h pelvic endome triosis)		Ca 125 II C-reactive protein (CRP) serum amyloid A (SAA) anticardiolipin antibody (aCL)	Show abstract
19232412	Endometrio sis	82 (34 women wi th no endometri osis, 48 women with endometrio sis)		CRP	Show abstract
9436699	Endometrio sis (pelvi c)	50 (15 women wi thout endometri osis, as confir med by laparosc opy (group A), 35 patients wit h pelvic endome triosis diagnos ed by laparosco py or laparotom y (group B))		CRP CA 125 II SAA Acl	Show abstract
20537326	Endometrio sis	48 (28 study pa tients, 20 cont rols)		RAGE EN-RAGE COX-2	Show abstract