Endometriosis Knowledgebase

Search Result

Gene id

1398

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CRK Gene UCSC Ensembl

Aliases

CRKII, p38

Gene name

CRK proto-oncogene, adaptor protein

Alternate names

adapter molecule crk, proto-oncogene c-Crk, v-crk avian sarcoma virus CT10 oncogene homolog, v-crk sarcoma virus CT10 oncogene-like protein,

Gene location

17p13.3 (1456266: 1421352) Exons: 3 NC_000017.11

Gene summary(Entrez)

This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytoplasmic proteins in the vicinity of tyrosine kinase through SH2-phosphotyrosine interaction. The N-terminal SH2 domain of this protein functions as a positive regulator of transformation whereas the C-terminal SH3 domain functions as a negative regulator of transformation. Two alternative transcripts encoding different isoforms with distinct biological activity have been described. [provided by RefSeq, Jul 2008]

OMIM

164762

Protein Summary

Protein general information

P46108

Name: Adapter molecule crk (Proto oncogene c Crk) (p38)

Length: 304 Mass: 33,831

Sequence

MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSP
AQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEED
LPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPS
VNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS

Structural information

Protein Domains	SH2. (13-118) SH3 (132-192) SH3 (237-296)
Interpro:	IPR000980 IPR011511 IPR001452
Prosite:	PS50001 PS50002
Pfam:	PF00017 PF00018 PF07653
PDB:	1JU5 2DVJ 2EYV 2EYW 2EYX 2EYY 2EYZ 2MS4
PDBsum:	1JU5 2DVJ 2EYV 2EYW 2EYX 2EYY 2EYZ 2MS4
DIP:	199
MINT:	1208745
STRING:	ENSP00000300574;

Other Databases

GeneCards: CRK; Malacards: CRK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000186	activation of MAPKK activ ity	TAS	biological_process
GO:0005070	SH3/SH2 adaptor activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	TAS	cellular_component
GO:0005737	cytoplasm	IC	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological_process
GO:0015629	actin cytoskeleton	IEA	cellular_component
GO:0032956	regulation of actin cytos keleton organization	IDA	biological_process
GO:0035020	regulation of Rac protein signal transduction	IEA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0042169	SH2 domain binding	IPI	molecular_function
GO:0043087	regulation of GTPase acti vity	IDA	biological_process
GO:0045309	protein phosphorylated am ino acid binding	IEA	molecular_function
GO:0046875	ephrin receptor binding	IPI	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0000186	activation of MAPKK activ ity	TAS	biological_process
GO:0005070	SH3/SH2 adaptor activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IC	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological_process
GO:0009967	positive regulation of si gnal transduction	IEA	biological_process
GO:0015629	actin cytoskeleton	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0030674	protein binding, bridging	IEA	molecular_function
GO:0032956	regulation of actin cytos keleton organization	IEA	biological_process
GO:0032956	regulation of actin cytos keleton organization	IDA	biological_process
GO:0035020	regulation of Rac protein signal transduction	IEA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0042169	SH2 domain binding	IPI	molecular_function
GO:0043087	regulation of GTPase acti vity	IDA	biological_process
GO:0045309	protein phosphorylated am ino acid binding	IEA	molecular_function
GO:0046875	ephrin receptor binding	IEA	molecular_function
GO:0046875	ephrin receptor binding	IPI	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0000186	activation of MAPKK activ ity	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	TAS	cellular_component
GO:0005737	cytoplasm	IC	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	TAS	biological_process
GO:0032956	regulation of actin cytos keleton organization	IDA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0042169	SH2 domain binding	IPI	molecular_function
GO:0043087	regulation of GTPase acti vity	IDA	biological_process
GO:0046875	ephrin receptor binding	IPI	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048013	ephrin receptor signaling pathway	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
PTHR19969:SF8  Angiogenesis
hsa04010  MAPK signaling pathway
hsa04015  Rap1 signaling pathway
hsa04510  Focal adhesion
hsa04062  Chemokine signaling pathway
hsa04810  Regulation of actin cytoskeleton
PTHR19969:SF9  Angiogenesis
hsa04722  Neurotrophin signaling pathway
hsa05220  Chronic myeloid leukemia
hsa04012  ErbB signaling pathway
hsa04910  Insulin signaling pathway
hsa05211  Renal cell carcinoma
PTHR19969:SF9  Integrin signalling pathway
hsa05100  Bacterial invasion of epithelial cells
hsa04666  Fc gamma R-mediated phagocytosis
hsa05131  Shigellosis
PTHR19969:SF8  Integrin signalling pathway
PTHR19969:SF8  CCKR signaling map

Diseases

Associated diseases	References
Endometriosis	PMID: 22012249
Endometriosis	INFBASE22012249

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22012249	Endometrio sis					miR-126 Crk	Show abstract