Endometriosis Knowledgebase

Search Result

Gene id

10987

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

COPS5 Gene UCSC Ensembl

Aliases

CSN5, JAB1, MOV-34, SGN5

Gene name

COP9 signalosome subunit 5

Alternate names

COP9 signalosome complex subunit 5, 38 kDa Mov34 homolog, COP9 constitutive photomorphogenic homolog subunit 5, jun activation domain-binding protein 1, signalosome subunit 5, testis secretory sperm-binding protein Li 231m,

Gene location

8q13.1 (67062326: 67043078) Exons: 8 NC_000008.11

Gene summary(Entrez)

The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. [provided by RefSeq, Jul 2008]

OMIM

604850

Protein Summary

Protein general information

Q92905

Name: COP9 signalosome complex subunit 5 (SGN5) (Signalosome subunit 5) (EC 3.4. . ) (Jun activation domain binding protein 1)

Length: 334 Mass: 37,579

Sequence

MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNL
EVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGI
DVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALE
VSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL
AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS

Structural information

Protein Domains	MPN. (53-164)
Motifs	JAMM motif.(138-151)
Interpro:	IPR000555
Pfam:	PF01398
PDB:	4D10 4D18 4F7O 4WSN 5JOG 5JOH 5M5Q
PDBsum:	4D10 4D18 4F7O 4WSN 5JOG 5JOH 5M5Q
DIP:	34546
MINT:	1188008
STRING:	ENSP00000350512;

Other Databases

GeneCards: COPS5; Malacards: COPS5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000338	protein deneddylation	IMP	biological_process
GO:0000715	nucleotide-excision repai r, DNA damage recognition	TAS	biological_process
GO:0003713	transcription coactivator activity	TAS	molecular_function
GO:0003743	translation initiation fa ctor activity	TAS	molecular_function
GO:0004843	thiol-dependent ubiquitin -specific protease activi ty	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005852	eukaryotic translation in itiation factor 3 complex	TAS	cellular_component
GO:0006283	transcription-coupled nuc leotide-excision repair	TAS	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological_process
GO:0006412	translation	TAS	biological_process
GO:0006413	translational initiation	IEA	biological_process
GO:0008021	synaptic vesicle	IDA	cellular_component
GO:0008180	COP9 signalosome	IDA	cellular_component
GO:0008180	COP9 signalosome	IDA	cellular_component
GO:0008237	metallopeptidase activity	IMP	molecular_function
GO:0010388	cullin deneddylation	IDA	biological_process
GO:0016579	protein deubiquitination	IDA	biological_process
GO:0030054	cell junction	IEA	cellular_component
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046328	regulation of JNK cascade	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:1903894	regulation of IRE1-mediat ed unfolded protein respo nse	IMP	biological_process
GO:1990182	exosomal secretion	IDA	biological_process
GO:0000338	protein deneddylation	IMP	biological_process
GO:0000715	nucleotide-excision repai r, DNA damage recognition	TAS	biological_process
GO:0003713	transcription coactivator activity	TAS	molecular_function
GO:0003743	translation initiation fa ctor activity	TAS	molecular_function
GO:0004843	thiol-dependent ubiquitin -specific protease activi ty	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005852	eukaryotic translation in itiation factor 3 complex	TAS	cellular_component
GO:0006283	transcription-coupled nuc leotide-excision repair	TAS	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological_process
GO:0006412	translation	TAS	biological_process
GO:0006413	translational initiation	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0008021	synaptic vesicle	IEA	cellular_component
GO:0008021	synaptic vesicle	IDA	cellular_component
GO:0008180	COP9 signalosome	IEA	cellular_component
GO:0008180	COP9 signalosome	IEA	cellular_component
GO:0008180	COP9 signalosome	IDA	cellular_component
GO:0008180	COP9 signalosome	IDA	cellular_component
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IMP	molecular_function
GO:0010388	cullin deneddylation	IDA	biological_process
GO:0016579	protein deubiquitination	IDA	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0030054	cell junction	IEA	cellular_component
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0045202	synapse	IEA	cellular_component
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046328	regulation of JNK cascade	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:1903894	regulation of IRE1-mediat ed unfolded protein respo nse	IMP	biological_process
GO:1990182	exosomal secretion	IDA	biological_process
GO:0000338	protein deneddylation	IMP	biological_process
GO:0000715	nucleotide-excision repai r, DNA damage recognition	TAS	biological_process
GO:0003713	transcription coactivator activity	TAS	molecular_function
GO:0003743	translation initiation fa ctor activity	TAS	molecular_function
GO:0004843	thiol-dependent ubiquitin -specific protease activi ty	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005852	eukaryotic translation in itiation factor 3 complex	TAS	cellular_component
GO:0006283	transcription-coupled nuc leotide-excision repair	TAS	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	TAS	biological_process
GO:0006412	translation	TAS	biological_process
GO:0008021	synaptic vesicle	IDA	cellular_component
GO:0008180	COP9 signalosome	IDA	cellular_component
GO:0008180	COP9 signalosome	IDA	cellular_component
GO:0008237	metallopeptidase activity	IMP	molecular_function
GO:0010388	cullin deneddylation	IDA	biological_process
GO:0016579	protein deubiquitination	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046328	regulation of JNK cascade	IDA	biological_process
GO:1903894	regulation of IRE1-mediat ed unfolded protein respo nse	IMP	biological_process
GO:1990182	exosomal secretion	IDA	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 25666480
Endometriosis	INFBASE25666480

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25666480	Endometrio sis			54 (26 endometr iosis, 28 non-e ndometriosis pa tients)		Jab1 p27	Show abstract