Endometriosis Knowledgebase

Search Result

Gene id

10893

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

MMP24 Gene UCSC Ensembl

Aliases

MMP-24, MMP25, MT-MMP 5, MT-MMP5, MT5-MMP, MT5MMP, MTMMP5

Gene name

matrix metallopeptidase 24

Alternate names

matrix metalloproteinase-24, matrix metallopeptidase 24 (membrane-inserted), matrix metalloproteinase 24 (membrane-inserted), membrane-type 5 matrix metalloproteinase, membrane-type matrix metalloproteinase 5,

Gene location

20q11.22 (35226735: 35277000) Exons: 10 NC_000020.11

Gene summary(Entrez)

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. Unlike most MMPs, which are secreted, this protease is a member of the membrane-type MMP (MT-MMP) subfamily, contains a transmembrane domain and is expressed at the cell surface. Substrates of this protease include the proteins cadherin 2 and matrix metallopeptidase 2 (also known as 72 kDa type IV collagenase). [provided by RefSeq, Feb 2016]

OMIM

604871

Protein Summary

Protein general information

Q9Y5R2

Name: Matrix metalloproteinase 24 (MMP 24) (EC 3.4.24. ) (Membrane type matrix metalloproteinase 5) (MT MMP 5) (MTMMP5) (Membrane type 5 matrix metalloproteinase) (MT5 MMP) (MT5MMP) [Cleaved into: Processed matrix metalloproteinase 24]

Length: 645 Mass: 73,231

Tissue specificity: Predominantly expressed in brain, kidney, pancreas and lung. Overexpressed in a series of brain tumors, including astrocytomas and glioblastomas. {ECO

Sequence

MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAGNRAAVAVAVARADEA
EAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSRR
RRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFA
SGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIM
APFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPSTPGT
KPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFVFFKGDKYWV
FKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQ
GAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSV
NAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV

Structural information

Motifs	Cysteine switch.(137-144) PDZ-binding. (643-645)
Interpro:	IPR000585 IPR018487 IPR018486 IPR033739 IPR024079 IPR028723 IPR001818 IPR021190 IPR021805 IPR016293 IPR006026 IPR002477
Prosite:	PS00024 PS51642 PS00142
Pfam:	PF11857 PF00045 PF00413 PF01471
CDD:	cd00094 cd04278
MINT:	7897838
STRING:	ENSP00000246186;

Other Databases

GeneCards: MMP24; Malacards: MMP24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004222	metalloendopeptidase acti vity	ISS	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005887	integral component of pla sma membrane	ISS	cellular_component
GO:0006508	proteolysis	ISS	biological_process
GO:0008047	enzyme activator activity	TAS	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0010001	glial cell differentiatio n	ISS	biological_process
GO:0032588	trans-Golgi network membr ane	ISS	cellular_component
GO:0043085	positive regulation of ca talytic activity	IEA	biological_process
GO:0044331	cell-cell adhesion mediat ed by cadherin	ISS	biological_process
GO:0045296	cadherin binding	IEA	molecular_function
GO:0050965	detection of temperature stimulus involved in sens ory perception of pain	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0097150	neuronal stem cell popula tion maintenance	ISS	biological_process
GO:0098609	cell-cell adhesion	ISS	biological_process
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004222	metalloendopeptidase acti vity	IEA	molecular_function
GO:0004222	metalloendopeptidase acti vity	ISS	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0005509	calcium ion binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0005887	integral component of pla sma membrane	IEA	cellular_component
GO:0005887	integral component of pla sma membrane	ISS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	ISS	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	TAS	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0008047	enzyme activator activity	TAS	molecular_function
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008237	metallopeptidase activity	IEA	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0010001	glial cell differentiatio n	IEA	biological_process
GO:0010001	glial cell differentiatio n	ISS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0032588	trans-Golgi network membr ane	IEA	cellular_component
GO:0032588	trans-Golgi network membr ane	ISS	cellular_component
GO:0043085	positive regulation of ca talytic activity	IEA	biological_process
GO:0044331	cell-cell adhesion mediat ed by cadherin	IEA	biological_process
GO:0044331	cell-cell adhesion mediat ed by cadherin	ISS	biological_process
GO:0045296	cadherin binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0050965	detection of temperature stimulus involved in sens ory perception of pain	IEA	biological_process
GO:0050965	detection of temperature stimulus involved in sens ory perception of pain	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0097150	neuronal stem cell popula tion maintenance	IEA	biological_process
GO:0097150	neuronal stem cell popula tion maintenance	ISS	biological_process
GO:0098609	cell-cell adhesion	IEA	biological_process
GO:0098609	cell-cell adhesion	ISS	biological_process
GO:0004222	metalloendopeptidase acti vity	ISS	molecular_function
GO:0004222	metalloendopeptidase acti vity	TAS	molecular_function
GO:0005887	integral component of pla sma membrane	ISS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006508	proteolysis	ISS	biological_process
GO:0006508	proteolysis	TAS	biological_process
GO:0008047	enzyme activator activity	TAS	molecular_function
GO:0010001	glial cell differentiatio n	ISS	biological_process
GO:0032588	trans-Golgi network membr ane	ISS	cellular_component
GO:0044331	cell-cell adhesion mediat ed by cadherin	ISS	biological_process
GO:0050965	detection of temperature stimulus involved in sens ory perception of pain	ISS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0097150	neuronal stem cell popula tion maintenance	ISS	biological_process
GO:0098609	cell-cell adhesion	ISS	biological_process

Diseases

Associated diseases	References
Attention-deficit hyperactivity disorder (ADHD)	PMID: 18839057
Endometriosis	PMID: 17952761
Endometriosis	INFBASE17952761

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17952761	Endometrio sis					MT5-MMP	Show abstract