Endometriosis Knowledgebase

Search Result

Gene id

1081

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CGA Gene UCSC Ensembl

Aliases

CG-ALPHA, FSHA, GPHA1, GPHa, HCG, LHA, TSHA

Gene name

glycoprotein hormones, alpha polypeptide

Alternate names

glycoprotein hormones alpha chain, FSH-alpha, LSH-alpha, TSH-alpha, anterior pituitary glycoprotein hormones common subunit alpha, choriogonadotropin alpha chain, chorionic gonadotrophin subunit alpha, chorionic gonadotropin, alpha polypeptide, follicle-stimulati,

Gene location

6q14.3 (87095146: 87085497) Exons: 5 NC_000006.12

Gene summary(Entrez)

The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

OMIM

118850

Protein Summary

Protein general information

P01215

Name: Glycoprotein hormones alpha chain (Anterior pituitary glycoprotein hormones common subunit alpha) (Choriogonadotropin alpha chain) (Chorionic gonadotrophin subunit alpha) (CG alpha) (Follicle stimulating hormone alpha chain) (FSH alpha) (Follitropin alpha

Length: 116 Mass: 13,075

Sequence

MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQK
NVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Structural information

Interpro:	IPR029034 IPR000476
Prosite:	PS00779 PS00780 PS50277
Pfam:	PF00236
PDB:	1DZ7 1E9J 1FL7 1HCN 1HD4 1HRP 1QFW 1XUL 1XWD 4AY9 4MQW
PDBsum:	1DZ7 1E9J 1FL7 1HCN 1HD4 1HRP 1QFW 1XUL 1XWD 4AY9 4MQW
DIP:	6182
MINT:	1197885
STRING:	ENSP00000358595;

Other Databases

GeneCards: CGA; Malacards: CGA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005179	hormone activity	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	NAS	biological_process
GO:0016486	peptide hormone processin g	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	NAS	biological_process
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IMP	molecular_function
GO:0005179	hormone activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	NAS	biological_process
GO:0016486	peptide hormone processin g	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	NAS	biological_process
GO:0005179	hormone activity	IMP	molecular_function
GO:0005179	hormone activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005796	Golgi lumen	TAS	cellular_component
GO:0007165	signal transduction	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	NAS	biological_process
GO:0016486	peptide hormone processin g	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	NAS	biological_process

KEGG pathways

hsa04080  Neuroactive ligand-receptor interaction
hsa04917  Prolactin signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04912  GnRH signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa05320  Autoimmune thyroid disease
hsa04918  Thyroid hormone synthesis

Diseases

Associated diseases	References
Adenomyosis	PMID: 7680356
Autism	PMID: 19598235
Cancer	PMID: 19692168
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Ectopic endometriosis	PMID: 1400884
Ectopic pregnancy	PMID: 6965436
Extrauterine pregnancy	PMID: 7052392
Female infertility	PMID: 25488203
Implantation failure	PMID: 18249366
Male infertility	PMID: 6601587
Oligomenorrhea	PMID: 8183759
Premature ovarian failure(POF)	PMID: 8629455
Secondary hyperprolactinaemia	PMID: 8183759
Semen quality	PMID: 21838882
Endometriosis (ectopic)	INFBASE1400884
Spermatogenetic defects	PMID: 21838882
Unexplained infertility	PMID: 3356777

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
1400884	Endometrio sis (ectop ic)			26 (12 normal p eritoneum from patients with e ndometriosis, 1 4 without endom etriosis)	Female infertility	hCG LHR	Show abstract