Endometriosis Knowledgebase

Search Result

Gene id

10401

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PIAS3 Gene UCSC Ensembl

Aliases

ZMIZ5

Gene name

protein inhibitor of activated STAT 3

Alternate names

E3 SUMO-protein ligase PIAS3, E3 SUMO-protein transferase PIAS3, protein inhibitor of activated STAT protein 3, zinc finger, MIZ-type containing 5,

Gene location

1q21.1 (54281177: 54273820) Exons: 15 NC_000019.10

Gene summary(Entrez)

This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008]

OMIM

605987

Protein Summary

Protein general information

Q9Y6X2

Name: E3 SUMO-protein ligase PIAS3 (EC 2.3.2.-) (E3 SUMO-protein transferase PIAS3) (Protein inhibitor of activated STAT protein 3)

Length: 628 Mass: 68,017

Tissue specificity: Widely expressed. {ECO

Sequence

MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDL
SLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFYEVYGELIRPTTLAST
SSQRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGY
LPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPY
ESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSPVQGGDPSENKKKVEVIDL
TIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGAD
IQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPG
GALREGHGGPLPSGPSLTGCRSDIISLD

Structural information

Protein Domains	SAP. (11-45) PINIT. (115-280)
Motifs	LXXLL motif.(19-23)
Interpro:	IPR027226 IPR023321 IPR038654 IPR003034 IPR036361 IPR004181 IPR013083
Prosite:	PS51466 PS50800 PS51044
Pfam:	PF14324 PF02891
PDB:	4MVT
PDBsum:	4MVT
DIP:	5969
MINT:
STRING:	ENSP00000376765;

Other Databases

GeneCards: PIAS3; Malacards: PIAS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0008022	protein C-terminus bindin g	IPI	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0009725	response to hormone	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0015459	potassium channel regulat or activity	IEA	molecular_function
GO:0016607	nuclear speck	IEA	cellular_component
GO:0016874	ligase activity	IEA	molecular_function
GO:0016925	protein sumoylation	ISS	biological_process
GO:0016925	protein sumoylation	IEA	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0019789	SUMO transferase activity	EXP	molecular_function
GO:0019789	SUMO transferase activity	EXP	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030425	dendrite	IEA	cellular_component
GO:0033234	negative regulation of pr otein sumoylation	IDA	biological_process
GO:0033235	positive regulation of pr otein sumoylation	IDA	biological_process
GO:0033235	positive regulation of pr otein sumoylation	IDA	biological_process
GO:0045202	synapse	IEA	cellular_component
GO:0045838	positive regulation of me mbrane potential	IEA	biological_process
GO:0047485	protein N-terminus bindin g	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0008022	protein C-terminus bindin g	IEA	molecular_function
GO:0008022	protein C-terminus bindin g	IPI	molecular_function
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0009725	response to hormone	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0015459	potassium channel regulat or activity	IEA	molecular_function
GO:0016607	nuclear speck	IEA	cellular_component
GO:0016874	ligase activity	IEA	molecular_function
GO:0016925	protein sumoylation	IEA	biological_process
GO:0016925	protein sumoylation	ISS	biological_process
GO:0016925	protein sumoylation	IEA	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0019789	SUMO transferase activity	IEA	molecular_function
GO:0019789	SUMO transferase activity	IEA	molecular_function
GO:0019789	SUMO transferase activity	EXP	molecular_function
GO:0019789	SUMO transferase activity	EXP	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030425	dendrite	IEA	cellular_component
GO:0033234	negative regulation of pr otein sumoylation	IDA	biological_process
GO:0033235	positive regulation of pr otein sumoylation	IDA	biological_process
GO:0033235	positive regulation of pr otein sumoylation	IDA	biological_process
GO:0045202	synapse	IEA	cellular_component
GO:0045838	positive regulation of me mbrane potential	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0047485	protein N-terminus bindin g	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0008022	protein C-terminus bindin g	IPI	molecular_function
GO:0016925	protein sumoylation	ISS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0019789	SUMO transferase activity	EXP	molecular_function
GO:0019789	SUMO transferase activity	EXP	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0033234	negative regulation of pr otein sumoylation	IDA	biological_process
GO:0033235	positive regulation of pr otein sumoylation	IDA	biological_process
GO:0033235	positive regulation of pr otein sumoylation	IDA	biological_process

KEGG pathways

hsa04630 Jak-STAT signaling pathway
hsa04120 Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Endometriosis	PubMed27226311

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27226311	Endometrio sis						Show abstract