Endometriosis Knowledgebase

Search Result

Gene id

1026

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CDKN1A Gene UCSC Ensembl

Aliases

CAP20, CDKN1, CIP1, MDA-6, P21, SDI1, WAF1, p21CIP1

Gene name

cyclin dependent kinase inhibitor 1A

Alternate names

cyclin-dependent kinase inhibitor 1, CDK-interacting protein 1, CDK-interaction protein 1, DNA synthesis inhibitor, cyclin-dependent kinase inhibitor 1A (p21, Cip1), melanoma differentiation associated protein 6, wild-type p53-activated fragment 1,

Gene location

6p21.2 (36676459: 36687338) Exons: 6 NC_000006.12

Gene summary(Entrez)

This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-cyclin-dependent kinase2 or -cyclin-dependent kinase4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen, a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of cyclin-dependent kinase2, and may be instrumental in the execution of apoptosis following caspase activation. Mice that lack this gene have the ability to regenerate damaged or missing tissue. Multiple alternatively spliced variants have been found for this gene. [provided by RefSeq, Sep 2015]

OMIM

116899

SNPs

rs1801270

Strand:    Allele origin: A(unknown)/C(germline,unknown)  Allele change: A/C/T   Mutation type: snp

CM000668.2   g.36684194C>A
CM000668.2   g.36684194C>T
NC_000006.11   g.36651971C>A
NC_000006.12   g.36684194C>A
NC_000006.12   g.36684194C>T
NG_009364.1   g.10513C>A
NG_009364.1   g.10513C>T
NM_000389.4   c.93C>A
NM_000389.4   c.93C>T
NM_001220777.1   c.93C>A
NM_001220777.1   c.93C>T
NM_001220778.1   c.93C>A
NM_001220778.1   c.93C>T
NM_001291549.1   c.195C>A
NM_001291549.1   c.195C>T
NM_078467.2   c.93C>A
NM_078467.2   c.93C>T
NP_000380.1   p.Ser31=
NP_000380.1   p.Ser31Arg
NP_001207706.1   p.Ser31=
NP_001207706.1   p.Ser31Arg
NP_001207707.1   p.Ser31=
NP_001207707.1   p.Ser31Arg
NP_001278478.1   p.Ser65=
NP_001278478.1   p.Ser65Arg
NP_510867.1   p.Ser31=
NP_510867.1   p.Ser31Arg
XP_005248844.1   p.Ser65Arg
Clinical Significance: Benign

Protein Summary

Protein general information

P38936

Name: Cyclin dependent kinase inhibitor 1 (CDK interacting protein 1) (Melanoma differentiation associated protein 6) (MDA 6) (p21)

Length: 164 Mass: 18,119

Tissue specificity: Expressed in all adult tissues, with 5-fold lower levels observed in the brain.

Sequence

MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPK
LYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDF
YHSKRRLIFSKRKP

Structural information

Motifs	PIP-box K+4(140-164) Nuclear localization(141-156)
Interpro:	IPR003175 IPR029841
Pfam:	PF02234
PDB:	1AXC 2ZVV 2ZVW 4RJF 5E0U
PDBsum:	1AXC 2ZVV 2ZVW 4RJF 5E0U
DIP:	246
MINT:	104203
STRING:	ENSP00000244741;

Other Databases

GeneCards: CDKN1A; Malacards: CDKN1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000079	regulation of cyclin-depe ndent protein serine/thre onine kinase activity	TAS	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	TAS	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	IMP	biological_process
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IDA	cellular_component
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	TAS	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	TAS	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	IDA	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007265	Ras protein signal transd uction	IEP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0009636	response to toxic substan ce	IEA	biological_process
GO:0010165	response to X-ray	IEA	biological_process
GO:0010243	response to organonitroge n compound	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0019912	cyclin-dependent protein kinase activating kinase activity	IDA	molecular_function
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030332	cyclin binding	IEA	molecular_function
GO:0030890	positive regulation of B cell proliferation	IEA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0031668	cellular response to extr acellular stimulus	IMP	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0033158	regulation of protein imp ort into nucleus, translo cation	IEA	biological_process
GO:0034198	cellular response to amin o acid starvation	IMP	biological_process
GO:0034605	cellular response to heat	IEA	biological_process
GO:0042326	negative regulation of ph osphorylation	IDA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042771	intrinsic apoptotic signa ling pathway in response to DNA damage by p53 clas s mediator	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043068	positive regulation of pr ogrammed cell death	IEA	biological_process
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IEA	biological_process
GO:0046685	response to arsenic-conta ining substance	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IMP	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0050821	protein stabilization	TAS	biological_process
GO:0051412	response to corticosteron e	IEA	biological_process
GO:0055093	response to hyperoxia	IEA	biological_process
GO:0060574	intestinal epithelial cel l maturation	IEA	biological_process
GO:0070557	PCNA-p21 complex	IDA	cellular_component
GO:0071479	cellular response to ioni zing radiation	IMP	biological_process
GO:0071493	cellular response to UV-B	ISS	biological_process
GO:0071850	mitotic cell cycle arrest	IEA	biological_process
GO:0090398	cellular senescence	IMP	biological_process
GO:0090399	replicative senescence	IEA	biological_process
GO:0090400	stress-induced premature senescence	TAS	biological_process
GO:0097193	intrinsic apoptotic signa ling pathway	TAS	biological_process
GO:1904031	positive regulation of cy clin-dependent protein ki nase activity	IEA	biological_process
GO:2000134	negative regulation of G1 /S transition of mitotic cell cycle	IGI	biological_process
GO:2000278	regulation of DNA biosynt hetic process	IEA	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IMP	biological_process
GO:0000079	regulation of cyclin-depe ndent protein serine/thre onine kinase activity	IEA	biological_process
GO:0000079	regulation of cyclin-depe ndent protein serine/thre onine kinase activity	TAS	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	TAS	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	IMP	biological_process
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IEA	cellular_component
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IDA	cellular_component
GO:0004860	protein kinase inhibitor activity	IEA	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	IEA	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	IEA	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	TAS	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	TAS	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	TAS	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	IDA	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007050	cell cycle arrest	IEA	biological_process
GO:0007050	cell cycle arrest	IEA	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007265	Ras protein signal transd uction	IEP	biological_process
GO:0007346	regulation of mitotic cel l cycle	IEA	biological_process
GO:0007346	regulation of mitotic cel l cycle	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0009411	response to UV	IEA	biological_process
GO:0009636	response to toxic substan ce	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010165	response to X-ray	IEA	biological_process
GO:0010243	response to organonitroge n compound	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010942	positive regulation of ce ll death	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0019912	cyclin-dependent protein kinase activating kinase activity	IDA	molecular_function
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030332	cyclin binding	IEA	molecular_function
GO:0030890	positive regulation of B cell proliferation	IEA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0031668	cellular response to extr acellular stimulus	IMP	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0033158	regulation of protein imp ort into nucleus, translo cation	IEA	biological_process
GO:0034198	cellular response to amin o acid starvation	IEA	biological_process
GO:0034198	cellular response to amin o acid starvation	IMP	biological_process
GO:0034605	cellular response to heat	IEA	biological_process
GO:0042326	negative regulation of ph osphorylation	IDA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042771	intrinsic apoptotic signa ling pathway in response to DNA damage by p53 clas s mediator	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043068	positive regulation of pr ogrammed cell death	IEA	biological_process
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IEA	biological_process
GO:0046685	response to arsenic-conta ining substance	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048146	positive regulation of fi broblast proliferation	IMP	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0050821	protein stabilization	TAS	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051412	response to corticosteron e	IEA	biological_process
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:0055093	response to hyperoxia	IEA	biological_process
GO:0060574	intestinal epithelial cel l maturation	IEA	biological_process
GO:0070557	PCNA-p21 complex	IDA	cellular_component
GO:0071479	cellular response to ioni zing radiation	IEA	biological_process
GO:0071479	cellular response to ioni zing radiation	IMP	biological_process
GO:0071493	cellular response to UV-B	IEA	biological_process
GO:0071493	cellular response to UV-B	ISS	biological_process
GO:0071850	mitotic cell cycle arrest	IEA	biological_process
GO:0072331	signal transduction by p5 3 class mediator	IEA	biological_process
GO:0090398	cellular senescence	IMP	biological_process
GO:0090399	replicative senescence	IEA	biological_process
GO:0090400	stress-induced premature senescence	TAS	biological_process
GO:0097193	intrinsic apoptotic signa ling pathway	TAS	biological_process
GO:1904031	positive regulation of cy clin-dependent protein ki nase activity	IEA	biological_process
GO:2000134	negative regulation of G1 /S transition of mitotic cell cycle	IGI	biological_process
GO:2000278	regulation of DNA biosynt hetic process	IEA	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IEA	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IMP	biological_process
GO:0000079	regulation of cyclin-depe ndent protein serine/thre onine kinase activity	TAS	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	TAS	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	IMP	biological_process
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IDA	cellular_component
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	TAS	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	TAS	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	TAS	molecular_function
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	IDA	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007265	Ras protein signal transd uction	IEP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0019912	cyclin-dependent protein kinase activating kinase activity	IDA	molecular_function
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0031668	cellular response to extr acellular stimulus	IMP	biological_process
GO:0034198	cellular response to amin o acid starvation	IMP	biological_process
GO:0042326	negative regulation of ph osphorylation	IDA	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IMP	biological_process
GO:0050821	protein stabilization	TAS	biological_process
GO:0070557	PCNA-p21 complex	IDA	cellular_component
GO:0071479	cellular response to ioni zing radiation	IMP	biological_process
GO:0071493	cellular response to UV-B	ISS	biological_process
GO:0090398	cellular senescence	IMP	biological_process
GO:0090400	stress-induced premature senescence	TAS	biological_process
GO:0097193	intrinsic apoptotic signa ling pathway	TAS	biological_process
GO:2000134	negative regulation of G1 /S transition of mitotic cell cycle	IGI	biological_process
GO:2000379	positive regulation of re active oxygen species met abolic process	IMP	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa05166  HTLV-I infection
hsa05205  Proteoglycans in cancer
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05161  Hepatitis B
hsa05224  Breast cancer
hsa04630  Jak-STAT signaling pathway
hsa04068  FoxO signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
hsa01522  Endocrine resistance
hsa04066  HIF-1 signaling pathway
hsa05160  Hepatitis C
hsa04110  Cell cycle
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa01524  Platinum drug resistance
hsa04012  ErbB signaling pathway
hsa05219  Bladder cancer
hsa04115  p53 signaling pathway
hsa05214  Glioma
hsa04921  Oxytocin signaling pathway

Diseases

Associated diseases	References
Atherosclerosis	PMID: 17351341
Cancer	PMID: 18361427
Cervical cancer	KEGG: H00030
Endometriosis	PMID: 23899551
Endometriosis	PMID: 11436200
Glaucoma	PMID: 14738489
Lupus erythematosus	PMID: 16837471
Endometriosis	INFBASE23899551
Systemic lupus erythematosus	PMID: 19262578

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23899551	Endometrio sis			41 (15 endometr ium from patien ts, 26 endometr ium from contro ls)		HOXA10 ESR1 CDH1 CDKN1A HRH4 HIST2H3C	Show abstract