Endometriosis Knowledgebase

Search Result

Gene id

10011

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SRA1 Gene UCSC Ensembl

Aliases

SRA, SRAP, STRAA1, pp7684

Gene name

steroid receptor RNA activator 1

Alternate names

steroid receptor RNA activator 1, steroid receptor RNA activator 1 (complexes with NCOA1), steroid receptor RNA activator protein, steroid receptor coactivator,

Gene location

5q31.3 (17591986: 17505560) Exons: 13 NC_000017.11

Gene summary(Entrez)

Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA. [provided by RefSeq, Mar 2012]

OMIM

603819

Protein Summary

Protein general information

Q9HD15

Name: Steroid receptor RNA activator 1 (Steroid receptor RNA activator protein) (SRAP)

Length: 236 Mass: 25,673

Tissue specificity: Highly expressed in liver and skeletal muscle and to a lesser extent in brain. Also expressed in both normal and tumorigenic breast epithelial cell lines. Significantly up-regulated in human tumors of the breast, ovary, and uterus. {EC

Sequence

MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPM
GPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAG
GKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEK
NHTIPGFQQAS

Structural information

Interpro:	IPR009917
Pfam:	PF07304
PDB:	2MGX 4NBO
PDBsum:	2MGX 4NBO
MINT:
STRING:	ENSP00000337513;

Other Databases

GeneCards: SRA1; Malacards: SRA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0008283	cell proliferation	IDA	biological_process
GO:0015630	microtubule cytoskeleton	IDA	cellular_component
GO:0016922	ligand-dependent nuclear receptor binding	IEA	molecular_function
GO:0030154	cell differentiation	IDA	biological_process
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IBA	molecular_function
GO:0030529	intracellular ribonucleop rotein complex	IPI	cellular_component
GO:0042981	regulation of apoptotic p rocess	IDA	biological_process
GO:0045171	intercellular bridge	IDA	cellular_component
GO:2000273	positive regulation of re ceptor activity	IBA	biological_process
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0008283	cell proliferation	IDA	biological_process
GO:0015630	microtubule cytoskeleton	IDA	cellular_component
GO:0016922	ligand-dependent nuclear receptor binding	IEA	molecular_function
GO:0030154	cell differentiation	IDA	biological_process
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IEA	molecular_function
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IBA	molecular_function
GO:0030529	intracellular ribonucleop rotein complex	IEA	cellular_component
GO:0030529	intracellular ribonucleop rotein complex	IPI	cellular_component
GO:0042981	regulation of apoptotic p rocess	IDA	biological_process
GO:0045171	intercellular bridge	IDA	cellular_component
GO:1903506	regulation of nucleic aci d-templated transcription	IEA	biological_process
GO:2000273	positive regulation of re ceptor activity	IBA	biological_process
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0008283	cell proliferation	IDA	biological_process
GO:0015630	microtubule cytoskeleton	IDA	cellular_component
GO:0030154	cell differentiation	IDA	biological_process
GO:0030374	ligand-dependent nuclear receptor transcription co activator activity	IBA	molecular_function
GO:0030529	intracellular ribonucleop rotein complex	IPI	cellular_component
GO:0042981	regulation of apoptotic p rocess	IDA	biological_process
GO:0045171	intercellular bridge	IDA	cellular_component
GO:2000273	positive regulation of re ceptor activity	IBA	biological_process

Diseases

Associated diseases	References
Ovarian cancer	GAD19064572
Narcolepsy	GAD20677014
Lung cancer	GAD18676680
Chronic obstructive pulmonary disease (COPD)	GAD19625176
Breast cancer	GAD18950845
Bladder cancer	GAD19692168
Endometriosis	PubMed27694140

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27694140	Endometrio sis					ESR1 ESR2	Show abstract